KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c5465Help
Entry
c5465             CDS       T00106                                 

Gene name
deoC
Definition
(GenBank) Deoxyribose-phosphate aldolase
  KO
K01619  deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    c5465 (deoC)
Enzymes [BR:ecc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     c5465 (deoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC His_biosynth
Motif
Other DBs
NCBI-ProteinID: AAN83885
UniProt: P0A6L1
Structure
PDB: 

Position
5206017..5206820
Genome map
AA seq 267 aa AA seqDB search
MATSQENEMTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRF
IPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMA
GNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGK
VAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARH
YRFGASSLLASLLKALGHGDGKSASSY
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttggcgacaagccaggagaatgaaatgactgatctgaaagcaagcagcctgcgtgcactg
aaattgatggacctgaccaccctgaatgacgacgacaccgatgagaaagtgatcgccctg
tgtcatcaggccaaaactccggtcggcaataccgccgctatctgtatctatcctcgcttt
atcccgattgctcgcaaaactctgaaagagcagggcaccccggaaatccgtatcgctacg
gtaactaacttcccacacggtaacgacgacatcgacattgcgctggcagaaacccgtgcg
gcaatcgcctatggtgccgatgaagttgacgtggtgttcccgtaccgcgcgctgatggcg
ggtaacgagcaggttggttttgacctggtgaaagcctgtaaagaggcttgcgctgcggcg
aacgtactgctgaaagtgattattgaaaccggcgaactgaaagacgaagcgctgatccgt
aaagcgtctgaaatctccatcaaagcgggtgctgacttcatcaaaacctctaccggtaaa
gtggctgtgaatgcgacgccggaaagcgcgcgcatcatgatggaagtgatccgcgatatg
ggcgtagaaaaaaccgttggtttcaaaccggcgggcggcgtgcgtactgcggaagatgcg
cagaaatatctcgccattgcagatgaactgttcggtgctgactgggctgatgcgcgtcac
taccgctttggtgcttccagcttgctggcaagcctgctgaaagctctgggccacggcgac
ggtaagagcgccagcagctactaa

DBGET integrated database retrieval system