KEGG   Escherichia coli K-12 DH10B: ECDH10B_0101Help
Entry
ECDH10B_0101      CDS       T00666                                 

Gene name
speE
Definition
(GenBank) spermidine synthase (putrescine aminopropyltransferase)
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00270  Cysteine and methionine metabolism
ecd00330  Arginine and proline metabolism
ecd00410  beta-Alanine metabolism
ecd00480  Glutathione metabolism
ecd01100  Metabolic pathways
Module
ecd_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECDH10B_0101 (speE)
   00330 Arginine and proline metabolism
    ECDH10B_0101 (speE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECDH10B_0101 (speE)
   00480 Glutathione metabolism
    ECDH10B_0101 (speE)
Enzymes [BR:ecd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     ECDH10B_0101 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_11 MTS Methyltransf_31 Methyltransf_12 MetW
Motif
Other DBs
NCBI-ProteinID: ACB01300
UniProt: B1XC96
Structure
PDB: 

Position
complement(109702..110568)
Genome map
AA seq 288 aa AA seqDB search
MAEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDE
FIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQY
LPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPIGPGESLFTSAFYEGCKR
CLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTFAWATDND
ALRHLSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQPS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaaaaacagtggcatgaaacgctacacgaccagtttgggcagtactttgcg
gtagataacgttctgtatcatgaaaagaccgatcaccaggatctgatcatttttgagaac
gctgcatttggtcgcgtaatggcgctggatggcgtagtacaaaccaccgagcgcgacgag
tttatctatcatgagatgatgacccatgttccgctactggcccatggtcacgcgaaacat
gtgctgattatcggcggcggcgacggtgccatgctgcgtgaagtaacccgacataaaaac
gttgagtcaatcacgatggtggaaatcgatgcgggtgtcgtatcgttctgccgtcagtat
ctacccaaccataacgccggtagctacgacgatccgcgctttaagctggtgatcgacgat
ggcgtcaatttcgttaatcaaaccagccagacctttgatgtcattatctccgactgcacc
gatcctatcggtcccggcgaaagccttttcacttcggcattttatgaaggctgcaaacgt
tgcctgaatcctggcggtatcttcgtcgcacaaaacggcgtctgctttttacagcaggaa
gaagccatcgacagccatcgcaaactcagccattacttcagcgacgttggcttttatcag
gcggcgatcccgacctattacggcggtatcatgacttttgcatgggcgacagataacgac
gccttacgccatctctcaaccgaaattattcaggcgcgttttctcgcctctggcctgaaa
tgccgttattacaatccggcaatccatacggcagcttttgccttacctcagtatctgcaa
gacgcactggcttcacagccgtcctaa

DBGET integrated database retrieval system