KEGG   Escherichia coli K-12 DH10B: ECDH10B_0793Help
Entry
ECDH10B_0793      CDS       T00666                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyltranssuccinase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00020  Citrate cycle (TCA cycle)
ecd00310  Lysine degradation
ecd01100  Metabolic pathways
ecd01110  Biosynthesis of secondary metabolites
ecd01120  Microbial metabolism in diverse environments
ecd01130  Biosynthesis of antibiotics
ecd01200  Carbon metabolism
Module
ecd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECDH10B_0793 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ECDH10B_0793 (sucB)
Enzymes [BR:ecd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ECDH10B_0793 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: ACB01935
Structure
PDB: 

Position
813337..814554
Genome map
AA seq 405 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAAAPAAQPALAARSEKRVP
MTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVK
AVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIK
ELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNG
QVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggtccctgacctgcctgaatccgtagccgatgccaccgtc
gcaacctggcataaaaaacccggcgacgcagtcgtacgtgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcagacggcattctggatgcggtt
ctggaagatgaaggtacaacggtaacgtctcgtcagatccttggtcgcctgcgtgaaggc
aacagcgccggtaaagaaaccagcgccaaatctgaagagaaagcgtccactccggcgcaa
cgccagcaggcgtctctggaagagcaaaacaacgatgcgttaagcccggcgatccgtcgc
ctgctggctgaacacaatctcgacgccagcgccattaaaggcaccggtgtgggtggtcgt
ctgactcgtgaagatgtggaaaaacatctggcgaaagccccggcgaaagagtctgctccg
gcagcggctgctccggcggcgcaaccggctctggctgcacgtagtgaaaaacgtgtcccg
atgactcgcctgcgtaagcgtgtggcagagcgtctgctggaagcgaaaaactccaccgcc
atgctgaccacgttcaacgaagtcaacatgaagccgattatggatctgcgtaagcagtac
ggtgaagcgtttgaaaaacgccacggcatccgtctgggctttatgtccttctacgtgaaa
gcggtggttgaagccctgaaacgttacccggaagtgaacgcttctatcgacggcgatgac
gtggtttaccacaactatttcgacgtcagcatggcggtttctacgccgcgcggcctggtg
acgccggttctgcgtgatgtcgataccctcggcatggcagacatcgagaagaaaatcaaa
gagctggcagtcaaaggccgtgacggcaagctgaccgttgaagatctgaccggtggtaac
ttcaccatcaccaacggtggtgtgttcggttccctgatgtctacgccgatcatcaacccg
ccgcagagcgcaattctgggtatgcacgctatcaaagatcgtccgatggcggtgaatggt
caggttgagatcctgccgatgatgtacctggcgctgtcctacgatcaccgtctgatcgat
ggtcgcgaatccgtgggcttcctggtaacgatcaaagagttgctggaagatccgacgcgt
ctgctgctggacgtgtag

DBGET integrated database retrieval system