KEGG   Escherichia coli K-12 DH10B: ECDH10B_3732Help
Entry
ECDH10B_3732      CDS       T00666                                 

Gene name
tiaE
Definition
(GenBank) 2-keto-D-gluconate reductase (glyoxalate reductase) (2-ketoaldonate reductase)
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00030  Pentose phosphate pathway
ecd00260  Glycine, serine and threonine metabolism
ecd00620  Pyruvate metabolism
ecd00630  Glyoxylate and dicarboxylate metabolism
ecd01100  Metabolic pathways
ecd01110  Biosynthesis of secondary metabolites
ecd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECDH10B_3732 (tiaE)
   00620 Pyruvate metabolism
    ECDH10B_3732 (tiaE)
   00630 Glyoxylate and dicarboxylate metabolism
    ECDH10B_3732 (tiaE)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECDH10B_3732 (tiaE)
Enzymes [BR:ecd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     ECDH10B_3732 (tiaE)
    1.1.1.81  hydroxypyruvate reductase
     ECDH10B_3732 (tiaE)
    1.1.1.215  gluconate 2-dehydrogenase
     ECDH10B_3732 (tiaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACB04603
UniProt: B1X8G8
Position
3812910..3813884
Genome map
AA seq 324 aa AA seqDB search
MKPSVILYKALPDDLLQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVNAAL
LEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVE
VAERVKAGEWTASIGPDWYGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHH
KEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAEQFAKMKSSAIFINAGRGPV
VDENALIAALQKGEIHAAGLDVFEQEPLSVDSPLLSMANVVAVPHIGSATHETRYGMAAC
AVDNLIDALQGKVEKNCVNPHVAD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtccgttatcctctacaaagccttacctgatgatttactgcaacgcctgcaa
gagcatttcaccgttcaccaggtggcaaacctcagcccacaaaccgtcgaacaaaatgca
gcaatttttgccgaagctgaaggtttactgggttcaaacgagaatgtaaatgccgcattg
ctggaaaaaatgccgaaactgcgtgccacatcaacgatctccgtcggctatgacaatttt
gatgtcgatgcgcttaccgcccgaaaaattctgctgatgcacacgccaaccgtattaaca
gaaaccgtcgccgatacgctgatggcgctggtgttgtctaccgctcgtcgggttgtggag
gtagcagaacgggtaaaagcaggcgaatggaccgcgagcataggcccggactggtacggc
actgacgttcaccataaaacactgggcattgtcgggatgggacggatcggcatggcgctg
gcacaacgtgcgcactttggcttcaacatgcccatcctctataacgcgcgccgccaccat
aaagaagcagaagaacgcttcaacgcccgctactgcgatttggatactctgttacaagag
tcagatttcgtttgcctgatcctgccgttaactgatgagacgcatcatctgtttggcgca
gaacaattcgccaaaatgaaatcctccgccattttcattaatgccggacgtggcccggtg
gttgacgaaaatgcactgatcgcagcattgcagaaaggcgaaattcacgctgccgggctg
gatgtcttcgaacaagagccactgtccgtagattcgccgttgctctcaatggccaacgtc
gtcgcagtaccgcatattggatctgccacccatgagacgcgttatggcatggccgcctgt
gccgtggataatttgattgatgcgttacaaggaaaggttgagaagaactgtgtgaatccg
cacgtcgcggactaa

DBGET integrated database retrieval system