KEGG   Escherichia coli K-12 DH10B: ECDH10B_3741Help
Entry
ECDH10B_3741      CDS       T00666                                 

Gene name
ysaB
Definition
(GenBank) predicted protein
Organism
ecd  Escherichia coli K-12 DH10B
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YsaB
Motif
Other DBs
NCBI-ProteinID: ACB04611
Position
complement(3821013..3821312)
Genome map
AA seq 99 aa AA seqDB search
MMMNAFFPAMALMVLVGCSIPSPVQKAQRVKVDPLRSLNMEALCKDQAAKRYNTGEQKID
VTAFEQFQGSYEMRGYTFRKEQFVCSFDADGHFLHLSMR
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaacgctttctttccggcaatggcgcttatggtgctagtgggttgttctata
ccgtcacccgtgcagaaagcacaacgggtaaaggttgatcctctgcgttcgttgaatatg
gaagcgttatgcaaggatcaggcggcaaaacgttataacaccggcgagcaaaaaatcgac
gtcaccgccttcgaacagttccagggaagctatgaaatgcgcggttataccttccgtaaa
gagcagtttgtctgttcttttgacgcggatggccattttttgcatctttccatgcgttaa

DBGET integrated database retrieval system