KEGG   Escherichia coli K-12 DH10B: ECDH10B_3747Help
Entry
ECDH10B_3747      CDS       T00666                                 

Gene name
xylF
Definition
(GenBank) D-xylose transporter subunit; periplasmic-binding component of ABC superfamily
  KO
K10543  D-xylose transport system substrate-binding protein
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd02010  ABC transporters
Module
ecd_M00215  D-Xylose transport system
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECDH10B_3747 (xylF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecd02000]
    ECDH10B_3747 (xylF)
Transporters [BR:ecd02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Xylose transporter [MD:M00215] [OT]
    ECDH10B_3747 (xylF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: ACB04617
Structure
PDB: 

Position
3826731..3827723
Genome map
AA seq 330 aa AA seqDB search
MKIKNILLTLCTSLLLTNVAAHAKEVKIGMAIDDLRLERWQKDRDIFVKKAESLGAKVFV
QSANGNEETQMSQIENMINRGVDVLVIIPYNGQVLSNVVKEAKQEGIKVLAYDRMINDAD
IDFYISFDNEKVGELQAKALVDIVPQGNYFLMGGSPVDNNAKLFRAGQMKVLKPYVDSGK
IKVVGDQWVDGWLPENALKIMENALTANNNKIDAVVASNDATAGGAIQALSAQGLSGKVA
ISGQDADLAGIKRIAAGTQTMTVYKPITLLANTAAEIAVELGNGQEPKADTTLNNGLKDV
PSRLLTPIDVNKNNIKDTVIKDGFHKESEL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaagaacattctactcaccctttgcacctcactcctgcttaccaacgttgct
gcacacgccaaagaagtcaaaataggtatggcgattgatgatctccgtcttgaacgctgg
caaaaagatcgagatatctttgtgaaaaaggcagaatctctcggcgcgaaagtatttgta
cagtctgcaaatggcaatgaagaaacacaaatgtcgcagattgaaaacatgataaaccgg
ggtgtcgatgttcttgtcattattccgtataacggtcaggtattaagtaacgttgtaaaa
gaagccaaacaagaaggcattaaagtattagcttacgaccgtatgattaacgatgcggat
atcgatttttatatttctttcgataacgaaaaagtcggtgaactgcaggcaaaagccctg
gtcgatattgttccgcaaggtaattacttcctgatgggcggctcgccggtagataacaac
gccaagctgttccgcgccggacaaatgaaagtgttaaaaccttacgttgattccggaaaa
attaaagtcgttggtgaccaatgggttgatggctggttaccggaaaacgcattgaaaatt
atggaaaacgcgctaaccgccaataataacaaaattgatgctgtagttgcctcaaacgat
gccaccgcaggtggggcaattcaggcattaagcgcgcaaggtttatcagggaaagtagca
atctccggccaggatgcggatctcgcaggtattaaacgtattgctgccggtacgcaaact
atgacggtgtataaacctattacgttgttggcaaatactgccgcagaaattgccgttgag
ttgggcaatggtcaggaaccaaaagcagataccacactgaataatggcctgaaagatgtc
ccctcccgcctcctgacaccgatcgatgtgaataaaaacaacatcaaagatacggtaatt
aaagacggattccacaaagagagcgagctgtaa

DBGET integrated database retrieval system