KEGG   Escherichia coli K-12 DH10B: ECDH10B_3755Help
Entry
ECDH10B_3755      CDS       T00666                                 

Gene name
yiaJ
Definition
(GenBank) predicted DNA-binding transcriptional repressor
  KO
K21602  IclR family transcriptional regulator, carbohydrate utilization repressor
Organism
ecd  Escherichia coli K-12 DH10B
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecd03000]
    ECDH10B_3755 (yiaJ)
Transcription factors [BR:ecd03000]
 Prokaryotic Type
  Helix-turn-helix
   IclR family
    ECDH10B_3755 (yiaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IclR HTH_IclR MarR_2 Rrf2 ApoA-II TrmB HTH_24
Motif
Other DBs
NCBI-ProteinID: ACB04625
Structure
PDB: 

Position
complement(3837284..3838132)
Genome map
AA seq 282 aa AA seqDB search
MGKEVMGKKENEMAQEKERPAGSQSLFRGLMLIEILSNYPNGCPLAHLSELAGLNKSTVH
RLLQGLQSCGYVTTAPAAGSYRLTTKFIAVGQKALSSLNIIHIAAPHLEALNIATGETIN
FSSREDDHAILIYKLEPTTGMLRTRAYIGQHMPLYCSAMGKIYMAFGHPDYVKSYWESHQ
HEIQPLTRNTITELPAMFDELAHIRESGAAMDREENELGVSCIAVPVFDIHGRVPYAVSI
SLSTSRLKQVGEKNLLKPLRETAQAISNELGFTVRDDLGAIT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagaagtgatgggaaaaaaagagaacgagatggcgcaggaaaaagagcgtcca
gccggaagccagagtctgtttcgcgggttgatgctgattgagattttgagcaactatcca
aacggttgtccgttggcgcatctttcggagctggctggtttaaataagagtaccgtccat
cgcttattgcagggattacagtcctgcggctatgtgaccaccgcgcctgccgcagggagt
tatcgcctgaccaccaaatttattgccgtcgggcagaaggcgctgtcttcgctgaatatc
attcatatcgccgctccgcatcttgaggcactgaacatcgccactggtgaaaccattaac
ttctccagccgcgaagacgatcacgctattttgatttataagctggaacccacaaccggg
atgctgcgaacccgtgcctatattggccagcatatgccgctctactgttccgcaatgggc
aagatctacatggcgtttggtcacccggactacgtgaagtcatactgggaaagccatcag
catgagatccagccgttaacccgcaataccattaccgagctgcccgcgatgttcgacgaa
ctggcgcacattcgtgaaagcggagcggcgatggacagagaagaaaacgaactcggcgtc
tcctgtattgctgttccggtgtttgatattcatgggcgggtgccgtacgccgtgtcgatt
tcgctttcgacatcacgtctgaaacaggtgggagagaaaaatctcctgaaaccactgcgt
gaaaccgcgcaggctatttctaatgaactgggatttactgtcagggatgacctgggcgcg
atcacataa

DBGET integrated database retrieval system