KEGG   Escherichia coli K-12 DH10B: ECDH10B_3765Help
Entry
ECDH10B_3765      CDS       T00666                                 

Gene name
yiaT
Definition
(GenBank) predicted protein
  KO
K07274  MipA family protein
Organism
ecd  Escherichia coli K-12 DH10B
Brite
Transporters [BR:ecd02000]
 Other Transporters
  Others
   ECDH10B_3765 (yiaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MipA
Motif
Other DBs
NCBI-ProteinID: ACB04635
Position
complement(3846728..3847468)
Genome map
AA seq 246 aa AA seqDB search
MLINRNIVALFALPFMASATASELSIGAGAAYNESPYRGYNENTKAIPLISYEGDTFYVR
QTTLGFILSQSEKNELSLTASWMPLEFDPTDNDDYAMQQLDKRDSTAMAGVAWYHHERWG
TVKASAAADVLDNSNGWVGELSVFHKMQIGRLSLTPALGVLYYDENFSDYYYGISESESR
RSGLASYSAQDAWVPYVSLTAKYPIGEHVVLMASAGYSELPEEITDSPMIDRNESFTFVT
GVSWRF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttaattaatcgcaatattgtggcgttatttgcgttgccttttatggcaagcgcaact
gcttctgaattatccattggtgctggtgcggcttataatgaatcgccttatcgcggttat
aatgaaaatacgaaggcaattccgctgattagttatgaaggtgatactttttatgttcgt
cagaccacgttaggttttattctgtcgcaaagtgaaaaaaatgaacttagcctgaccgca
tcctggatgccgctggaatttgaccctaccgataatgacgattatgccatgcaacagctt
gataagcgtgatagtacggctatggcgggggttgcctggtatcaccacgagcgttgggga
accgtgaaagcctctgcagctgcggacgttctggataacagcaacggctgggtgggggag
ctatcggtattccacaaaatgcagataggtcgtctgtcgctgacacctgcgctgggcgtt
ctctattatgacgagaatttcagtgactattactatggcatttcagagagtgagtcccgt
cgtagcggtctggcaagttattccgcgcaggatgcctgggtgccctatgtcagcctgacg
gcaaaatacccgataggagagcacgtcgtattgatggcgagcgcaggatacagcgagctg
ccggaagagattaccgacagcccgatgattgatcgtaatgagagttttacctttgtcacc
ggggtgagctggcgtttttaa

DBGET integrated database retrieval system