KEGG   Escherichia coli K-12 DH10B: ECDH10B_3790Help
Entry
ECDH10B_3790      CDS       T00666                                 

Gene name
gpsA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase (NAD+)
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00564  Glycerophospholipid metabolism
ecd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECDH10B_3790 (gpsA)
Enzymes [BR:ecd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     ECDH10B_3790 (gpsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N ApbA F420_oxidored NAD_binding_2 UDPG_MGDP_dh_N GIDA 3HCDH_N NAD_binding_8 Rossmann-like TrkA_N Pyr_redox_2 IlvN Methyltransf_23 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ACB04658
UniProt: B1X942
Position
complement(3878242..3879261)
Genome map
AA seq 339 aa AA seqDB search
MNQRNASMTVIGAGSYGTALAITLARNGHEVVLWGHDPEHIATLERDRCNAAFLPDVPFP
DTLHLESDLATALAASRNILVVVPSHVFGEVLRQIKPLMRPDARLVWATKGLEAETGRLL
QDVAREALGDQIPLAVISGPTFAKELAAGLPTAISLASTDQTFADDLQQLLHCGKSFRVY
SNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRGLAEMSRLGAALGADPATF
MGMAGLGDLVLTCTDNQSRNRRFGMMLGQGMDVQSAQEKIGQVVEGYRNTKEVRELAHRF
GVEMPITEEIYQVLYCGKNAREAALTLLGRARKDERSSH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacgtaatgcttcaatgactgtgatcggtgccggctcgtacggcaccgctctt
gccatcaccctggcaagaaatggccacgaggttgtcctctggggccatgaccctgaacat
atcgcaacgcttgaacgcgaccgctgtaacgccgcgtttctccccgatgtgccttttccc
gatacgctccatcttgaaagcgatctcgccactgcgctggcagccagccgtaatattctc
gtcgtcgtacccagccatgtctttggtgaagtgctgcgccagattaaaccactgatgcgt
cctgatgcgcgtctggtgtgggcgaccaaagggctggaagcggaaaccggacgtctgtta
caggacgtggcgcgtgaggccttaggcgatcaaattccgctggcggttatctctggccca
acgtttgcgaaagaactggcggcaggtttaccgacagctatttcgctggcctcgaccgat
cagacctttgccgatgatctccagcagctgctgcactgcggcaaaagtttccgcgtttac
agcaatccggatttcattggcgtgcagcttggcggcgcggtgaaaaacgttattgccatt
ggtgcggggatgtccgacggtatcggttttggtgcgaatgcgcgtacggcgctgatcacc
cgtgggctggctgaaatgtcgcgtcttggtgcggcgctgggtgccgaccctgccaccttt
atgggcatggcggggcttggcgatctggtgcttacctgtaccgacaaccagtcgcgtaac
cgccgttttggcatgatgctcggtcagggcatggatgtacaaagcgcgcaggagaagatt
ggtcaggtggtggaaggctaccgcaatacgaaagaagtccgcgaactggcgcatcgcttc
ggcgttgaaatgccaataaccgaggaaatttatcaagtattatattgcggaaaaaacgcg
cgcgaggcagcattgactttactaggtcgtgcacgcaaggacgagcgcagcagccactaa

DBGET integrated database retrieval system