KEGG   Escherichia coli K-12 DH10B: ECDH10B_3805Help
Entry
ECDH10B_3805      CDS       T00666                                 

Gene name
rfaK
Definition
(GenBank) lipopolysaccharide core biosynthesis
  KO
K03277  heptosyltransferase IV [EC:2.4.-.-]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00540  Lipopolysaccharide biosynthesis
ecd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ECDH10B_3805 (rfaK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ecd01003]
    ECDH10B_3805 (rfaK)
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecd01005]
    ECDH10B_3805 (rfaK)
Enzymes [BR:ecd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     ECDH10B_3805 (rfaK)
Glycosyltransferases [BR:ecd01003]
 Polysaccharide
  Bacterial polysaccharide
   ECDH10B_3805 (rfaK)
Lipopolysaccharide biosynthesis proteins [BR:ecd01005]
 Core region
  ECDH10B_3805 (rfaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_9
Motif
Other DBs
NCBI-ProteinID: ACB04673
Position
complement(3893839..3894912)
Genome map
AA seq 357 aa AA seqDB search
MRLGTFHKKKRFYINKIKINFLSFLFRNKINNQITDPAQVKSCLIIHDNNKLGDLIVLSS
IYRELYSKGVKITLLTNRKGGEFLSNNKNIFEFCIKESTGFLEMLTLCKHLRDLQFDIVL
DPFETMPSFKHSLILSSLKDSYILGFDHWYKRYYSFYHPHDECLKEHMSTRAIEILKHIY
GEGKFSTNYDLHLPVDVEDKIKEFIGDTRIVIINPLGAKKICRLTFEQIKVIYQEVKTHF
ENYRIIFTGLPQDLLTIPILEIETLPFDEFIYTVALTKYSDFVISVDTALVHIAAAYHKP
TLAFYPNSRTPEYPSHLIWSPNHHKSIQIVSPTYTVKDIDTETLTNSVKRLSCIDKK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttaggaacttttcacaaaaagaaaagattttatataaacaaaatcaagattaat
ttcctttcttttttatttcgtaataaaataaataatcaaattacagatccagcacaagtt
aaatcatgccttattattcatgataataataaacttggtgatctaattgtattaagttcg
atttatcgtgaactttatagtaaaggggttaaaataactcttctcacaaatagaaagggt
ggggaatttctctctaataataaaaatatatttgagttctgtattaaagaatcaaccggt
tttcttgaaatgcttactctatgtaagcatctgcgggatttacagttcgatattgtatta
gacccctttgaaactatgccctcatttaagcatagcttaatattatcaagtttaaaagat
tcttacattctgggttttgatcattggtataagcgttactattcattttaccatccccac
gatgaatgtttaaaagaacatatgagtacacgagcaatagaaatactgaagcatatttat
ggtgagggtaaattttccaccaactacgacttgcatttaccagtagatgttgaagataaa
ataaaagaatttattggagatacaagaatagtcattattaatccattaggtgcaaaaaaa
atatgccgtcttacgtttgagcaaataaaagttatatatcaagaagtgaaaacacacttt
gaaaattatcggattatatttaccgggttaccgcaagatttattgacaataccaatactt
gaaatcgaaacactaccatttgatgagtttatttataccgttgcgttgaccaagtatagt
gattttgtcatttctgttgatacagctcttgttcatatcgctgcggcttatcataaacca
acgcttgcattttaccctaattcacgtactccggaatatccctcgcatttaatttggtcc
ccgaatcatcataaatctatacaaatagtatccccaacatatacggtaaaagatatcgat
actgaaactttaactaattcagtaaagagattaagttgtatagataagaagtga

DBGET integrated database retrieval system