KEGG   Escherichia coli K-12 DH10B: ECDH10B_3807Help
Entry
ECDH10B_3807      CDS       T00666                                 

Gene name
rfaY
Definition
(GenBank) lipopolysaccharide core biosynthesis protein
  KO
K02850  heptose II phosphotransferase [EC:2.7.1.-]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00540  Lipopolysaccharide biosynthesis
ecd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ECDH10B_3807 (rfaY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecd01005]
    ECDH10B_3807 (rfaY)
Enzymes [BR:ecd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     ECDH10B_3807 (rfaY)
Lipopolysaccharide biosynthesis proteins [BR:ecd01005]
 Core region
  ECDH10B_3807 (rfaY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WaaY RIO1 SecA_PP_bind NAD_Gly3P_dh_C
Motif
Other DBs
NCBI-ProteinID: ACB04675
Position
complement(3895867..3896565)
Genome map
AA seq 232 aa AA seqDB search
MIQKSKIKDLVVFTDENNSKYLNVLNDFLSYNINIIKVFRSIDDTKVMLIDTDYGKLILK
VFSPKVKRNERFFKSLLKGDYYERLFEQTQKVRNEGLNTLNDFYLLAERKTLRFVHTYIM
IIEYIDGIELCDMPDIDDALKNKIQQSINALHQHGMVSGDPHRGNFIIKNGEVRIIDLSG
KRASAQRKAKDRIDLERHYGIKNEIRDLGYYLLVYRKKMRNFMRRLKGKPAR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattcagaagagcaagatcaaagacttggttgtttttaccgatgaaaacaattcaaag
tacctcaatgtattaaatgacttcttgtcttataatataaatatcatcaaggtttttcgt
tctattgatgatacaaaagttatgcttattgataccgattacggtaaattgattcttaag
gttttttctccgaaagttaagcgtaacgaacgtttctttaagtctctgttaaaaggtgat
tattacgaacgcctttttgagcaaacccaaaaagtacgaaatgaagggttaaatacactc
aatgacttttatttattggctgaacggaaaaccttacgttttgtccatacttatatcatg
atcatcgagtatattgatggcatagagttgtgtgatatgcccgatattgatgatgcgcta
aaaaataaaattcagcaatcaattaatgccttacatcaacatggcatggtttctggcgac
ccccatcgtggtaacttcattataaaaaatggtgaggttcgaattatcgatctctccgga
aagcgtgcttcagcgcagcgtaaagcgaaagatcgtattgacttagagcgtcattacggt
attaaaaatgagattagagatctaggctattatcttttagtatatcgtaaaaaaatgcgc
aattttatgcggcgtttgaaagggaaaccagcgcgctaa

DBGET integrated database retrieval system