KEGG   Escherichia coli K-12 DH10B: ECDH10B_3816Help
Entry
ECDH10B_3816      CDS       T00666                                 

Gene name
coaD
Definition
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00770  Pantothenate and CoA biosynthesis
ecd01100  Metabolic pathways
Module
ecd_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ECDH10B_3816 (coaD)
Enzymes [BR:ecd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     ECDH10B_3816 (coaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like Citrate_ly_lig DUF3388
Motif
Other DBs
NCBI-ProteinID: ACB04684
UniProt: B1X968
Structure
PDB: 

Position
3905425..3905904
Genome map
AA seq 159 aa AA seqDB search
MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMFTLEERVALAQQATA
HLGNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMP
SKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgggcgatttatccgggtactttcgatcccattaccaatggtcatatcgat
atcgtgacgcgcgccacgcagatgttcgatcacgttattctggcgattgccgccagcccc
agtaaaaaaccgatgtttaccctggaagagcgtgtggcactggcacagcaggcaaccgcg
catctggggaacgtggaagtggtcgggtttagtgatttaatggcgaacttcgcccgtaat
caacacgctacggtgctgattcgtggcctgcgtgcggtggcagattttgaatatgaaatg
cagctggcgcatatgaatcgccacttaatgccggaactggaaagtgtgtttctgatgccg
tcgaaagagtggtcgtttatctcttcatcgttggtgaaagaggtggcgcgccatcagggc
gatgtcacccatttcctgccggagaatgtccatcaggcgctgatggcgaagttagcgtag

DBGET integrated database retrieval system