KEGG   Escherichia coli K-12 DH10B: ECDH10B_3845Help
Entry
ECDH10B_3845      CDS       T00666                                 

Gene name
yicM
Definition
(GenBank) predicted transporter
  KO
K03445  MFS transporter, DHA1 family, purine ribonucleoside efflux pump
Organism
ecd  Escherichia coli K-12 DH10B
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecd02000]
    ECDH10B_3845 (yicM)
Transporters [BR:ecd02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    ECDH10B_3845 (yicM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 DUF679 MFS_4
Motif
Other DBs
NCBI-ProteinID: ACB04711
Position
complement(3936156..3937511)
Genome map
AA seq 451 aa AA seqDB search
MDKTFTPHPVIFALFRFDLNSSSSNTVKVAKTLNASHISMLKWSAFPLKHATGNTMSEFI
AENRGADAITRPNWSAVFSVAFCVACLIIVEFLPVSLLTPMAQDLGISEGVAGQSVTVTA
FVAMFASLFITQTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGF
WAMSASLTMRLVPPRTVPKALSVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAVMGV
LCIFWIIKSLPSLPGEPSHQKQNTFRLLQRPGVMAGMIAIFMSFAGQFAFFTYIRPVYMN
LAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSVKLALAGAPLILAVSALVLTLWGSDK
IVATGVAIIWGLTFALVPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAAIGGYALD
NIGLTSPLMLSGTLMLLTALLVTAKVKMKKS
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtggataagacgttcacgccgcatccggtaatctttgccctgttccgtttcgatcttaac
tccagctcaagcaacaccgtaaaagttgcaaaaacgttaaatgcgtcacacatttcaatg
ttaaagtggtcggcttttcccctgaaacatgccacgggtaacaccatgagtgaatttatt
gccgaaaaccgcggcgcggatgccatcacccgaccgaactggtcagccgttttctcggtg
gcgttttgtgtcgcctgtctgattatcgttgagtttttgcccgtcagtttgttgacgcca
atggcccaggatttaggcatttcggaaggggttgccgggcaatcggtgaccgtgaccgcc
tttgtggcaatgtttgccagtttgtttattacccagacaattcaggctactgaccgccgc
tacgttgttattttgtttgccgttttgctgacgctctcctgcttgctggtttcctttgct
aactcattcagtttgcttttaatcggtcgtgcctgtctggggctggcgctgggcgggttc
tgggcgatgtcggcgtcgctgaccatgcgtctggtgccgccgcgtacggtgccgaaggcg
ctgtcggtgatcttcggcgcggtttctattgcgctggtgattgccgcgccgttgggcagt
tttttaggcgagcttatcggttggcgcaatgtctttaatgcggcggcggtgatgggcgtg
ctgtgtattttctggattatcaaatcattgccttcactgccaggcgaaccctcgcatcag
aaacaaaatactttccgcttattacaacgtccgggtgtgatggcagggatgatcgccatc
ttcatgtctttcgccgggcagtttgctttcttcacgtatattcgcccggtgtatatgaac
ctggcgggattcggcgtggatggcttaacgctggtgctgttgagttttggtatcgccagc
tttattggtacgtcgctttcgtcgttcattcttaaacgttcggtaaaactggccttagca
ggcgcgccgttaatactggctgtgagtgcgttggtactgacgttgtggggaagcgataaa
atcgttgctaccggcgtggcgattatctgggggctaacttttgcattggttcccgtcggc
tggtcaacgtggatcacccgctcgctggccgatcaggcagaaaaagccgggtctattcag
gtggcggttattcagcttgctaatacctgtggcgcggcaatcggcggttatgcgctggat
aatattggtctgacttcgccgttgatgttgtccggcacattgatgttgctgactgcattg
ttggttactgcaaaggtgaaaatgaagaaatcctga

DBGET integrated database retrieval system