KEGG   Escherichia coli K-12 DH10B: ECDH10B_3846Help
Entry
ECDH10B_3846      CDS       T00666                                 

Gene name
yicN
Definition
(GenBank) conserved protein
Organism
ecd  Escherichia coli K-12 DH10B
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1198 FxsA TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: ACB04712
Position
complement(3937557..3938009)
Genome map
AA seq 150 aa AA seqDB search
MIWIMLATLAVVFVVGFRVLTSGARKAIRRLSDRLNIDVVPVESMVDQMGKSAGDEFLRY
LHRPDESHLQNAAQVLLIWQIVIVDGSEQNLLQWHRILQKARLAAPITDAQVRLALGFLR
ETEPEMQDINAFQMRYNAFFQPAEGVHWLH
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgatctggataatgctcgccacgctggcggtagtgtttgtggttggttttcgggtgctg
acatccggggccagaaaagcgattcgccgtctcagcgatcggctgaacatcgatgtcgta
cccgtggagtcgatggtcgatcaaatgggaaagtcagctggtgacgaatttttacgttat
ttgcatcgtccggatgagtcgcacctgcaaaacgccgcgcaggtgttgctcatctggcaa
attgtcattgtcgatggtagcgaacagaacctgctgcaatggcatcggattttacaaaaa
gctcgcctcgccgcgccgattaccgacgctcaggtcaggctggcgctaggttttctgcgc
gaaaccgaacctgaaatgcaggatattaatgcttttcagatgcgctataacgcgttcttt
cagcctgccgagggcgttcactggttgcattga

DBGET integrated database retrieval system