KEGG   Escherichia coli K-12 DH10B: ECDH10B_3854Help
Entry
ECDH10B_3854      CDS       T00666                                 

Gene name
ilvB
Definition
(GenBank) acetolactate synthase I, large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00290  Valine, leucine and isoleucine biosynthesis
ecd00650  Butanoate metabolism
ecd00660  C5-Branched dibasic acid metabolism
ecd00770  Pantothenate and CoA biosynthesis
ecd01100  Metabolic pathways
ecd01110  Biosynthesis of secondary metabolites
ecd01130  Biosynthesis of antibiotics
ecd01210  2-Oxocarboxylic acid metabolism
ecd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ECDH10B_3854 (ilvB)
   00660 C5-Branched dibasic acid metabolism
    ECDH10B_3854 (ilvB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ECDH10B_3854 (ilvB)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ECDH10B_3854 (ilvB)
Enzymes [BR:ecd01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     ECDH10B_3854 (ilvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M CO_dh XFP_N
Motif
Other DBs
NCBI-ProteinID: ACB04720
Position
complement(3946703..3948391)
Genome map
AA seq 562 aa AA seqDB search
MASSGTTSTRKRFTGAEFIVHFLEQQGIKIVTGIPGGSILPVYDALSQSTQIRHILARHE
QGAGFIAQGMARTDGKPAVCMACSGPGATNLVTAIADARLDSIPLICITGQVPASMIGTD
AFQEVDTYGISIPITKHNYLVRHIEELPQVMSDAFRIAQSGRPGPVWIDIPKDVQTAVFE
IETQPAMAEKAAAPAFSEESIRDAAAMINAAKRPVLYLGGGVINAPARVRELAEKAQLPT
TMTLMALGMLPKAHPLSLGMLGMHGVRSTNYILQEADLLIVLGARFDDRAIGKTEQFCPN
AKIIHVDIDRAELGKIKQPHVAIQADVDDVLAQLIPLVEAQPRAEWHQLVADLQREFPCP
IPKACDPLSHYGLINAVAACVDDNAIITTDVGQHQMWTAQAYPLNRPRQWLTSGGLGTMG
FGLPAAIGAALANPDRKVLCFSGDGSLMMNIQEMATASENQLDVKIILMNNEALGLVHQQ
QSLFYEQGVFAATYPGKINFMQIAAGFGLETCDLNNEADPQASLQEIINRPGPALIHVRI
DAEEKVYPMVPPGAANTEMVGE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcaagttcgggcacaacatcgacgcgtaagcgctttaccggcgcagaatttatcgtt
catttcctggaacagcagggcattaagattgtgacaggcattccgggcggttctatcctg
cctgtttacgatgccttaagccaaagcacgcaaatccgccatattctggcccgtcatgaa
cagggcgcgggctttatcgctcagggaatggcgcgcaccgacggtaaaccggcggtctgt
atggcctgtagcggaccgggtgcgactaacctggtgaccgccattgccgatgcgcggctg
gactccatcccgctgatttgcatcactggtcaggttcccgcctcgatgatcggcaccgac
gccttccaggaagtggacacctacggcatctctatccccatcaccaaacacaactatctg
gtcagacatatcgaagaactcccgcaggtcatgagcgatgccttccgcattgcgcaatca
ggccgcccaggcccggtgtggatagacattcctaaggatgtgcaaacggcagtttttgag
attgaaacacagcccgctatggcagaaaaagccgccgcccccgcctttagcgaagaaagc
attcgtgacgcagcggcgatgattaacgctgccaaacgcccggtgctttatctgggcggc
ggtgtgatcaatgcgcccgcacgggtgcgtgaactggcggagaaagcgcaactgcctacc
accatgactttaatggcgctgggcatgttgccaaaagcgcatccgttgtcgctgggtatg
ctggggatgcacggcgtgcgcagcaccaactatattttgcaggaggcggatttgttgata
gtgctcggtgcgcgttttgatgaccgggcgattggcaaaaccgagcagttctgtccgaat
gccaaaatcattcatgtcgatatcgaccgtgcagagctgggtaaaatcaagcagccgcac
gtggcgattcaggcggatgttgatgacgtgctggcgcagttgatcccgctggtggaagcg
caaccgcgtgcagagtggcaccagttggtagcggatttgcagcgtgagtttccgtgtcca
atcccgaaagcgtgcgatccgttaagccattacggcctgatcaacgccgttgccgcctgt
gtcgatgacaatgcaattatcaccaccgacgttggtcagcatcagatgtggaccgcgcaa
gcttatccgctcaatcgcccacgccagtggctgacctccggtgggctgggcacgatgggt
tttggcctgcctgcggcgattggcgctgcgctggcgaacccggatcgcaaagtgttgtgt
ttctccggcgacggcagcctgatgatgaatattcaggagatggcgaccgccagtgaaaat
cagctggatgtcaaaatcattctgatgaacaacgaagcgctggggctggtgcatcagcaa
cagagtctgttctacgagcaaggcgtttttgccgccacctatccgggcaaaatcaacttt
atgcagattgccgccggattcggcctcgaaacctgtgatttgaataacgaagccgatccg
caggcttcattgcaggaaatcatcaatcgccctggcccggcgctgatccatgtgcgcatt
gatgccgaagaaaaagtttacccgatggtgccgccaggtgcggcgaatactgaaatggtg
ggggaataa

DBGET integrated database retrieval system