KEGG   Escherichia coli K-12 DH10B: ECDH10B_4057Help
Entry
ECDH10B_4057      CDS       T00666                                 

Gene name
hemN
Definition
(GenBank) coproporphyrinogen III oxidase, SAM and NAD(P)H dependent, oxygen-independent
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00860  Porphyrin and chlorophyll metabolism
ecd01100  Metabolic pathways
ecd01110  Biosynthesis of secondary metabolites
Module
ecd_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECDH10B_4057 (hemN)
Enzymes [BR:ecd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     ECDH10B_4057 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ACB04881
Structure
PDB: 

Position
4148988..4150361
Genome map
AA seq 457 aa AA seqDB search
MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGRHVSQLHWGGGTPTYLNK
AQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVF
NYAHLPTIFAAQRKIKDADLPSPQQKLDILQETIAFLTQSGYQFIGMDHFARPDDELAVA
QREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDCYAQNQKELKQYYQQVDEQGNALWRG
IALTRDDCIRRDVIKSLICNFRLDYAPIEKQWDLHFADYFAEDLKLLAPLAKDGLVDVDE
KGIQVTAKGRLLIRNICMCFDTYLRQKARMQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacagcaaatcgactgggatctggccctgatccagaaatataactattccggg
ccacgatacacctcgtacccgaccgcgctggagttttcagaagacttcggcgaacaggcg
tttttacaagccgtggcgcgctatcctgagcgtccattatctctctacgtacatatcccg
ttctgccataagctttgttacttctgcggttgcaataagattgttactcgccagcagcac
aaggccgatcagtatctggacgcgctggagcaagaaatcgtccatcgtgcaccgctgttc
gccgggcgtcacgtcagccaattgcactggggcggcggaacgccgacgtatctgaataaa
gcgcaaatcagccgcctgatgaagctgctgcgcgaaaacttccagttcaatgccgatgcg
gagatttcgatcgaagtcgatccgcgggaaatcgaactggatgtactcgatcatttacgc
gccgaaggctttaatcgcctgagcatgggcgtgcaggacttcaacaaagaagtgcaacgt
ctggttaaccgcgagcaggatgaagagttcatctttgcactgcttaaccatgcgcgtgag
attggttttacctccaccaacatcgacctgatttacggcctgccgaaacagacgccggag
agtttcgcctttaccctgaaacgtgtggcggagctgaaccccgatcgtctgagtgtcttt
aactacgcgcatctgccgaccatttttgctgctcagcgcaaaatcaaagatgctgacctg
ccgagtccgcagcaaaaactcgatatcctgcaggaaaccatcgccttcctgacgcaatcg
ggctatcagtttatcggtatggatcactttgcccgtccggatgacgagctggcggtggcc
cagcgtgaaggcgtgctgcatcgtaacttccagggctacaccactcagggcgataccgat
ctgctggggatgggcgtttccgccatcagcatgattggcgactgctacgcgcagaaccag
aaagagttgaagcagtactatcagcaagtggatgaacaaggcaatgcgctgtggcgtggt
attgcgctaacgcgtgatgactgtattcgccgcgatgtgattaagtcgctcatctgcaac
ttccgtctggattacgcccctattgagaaacagtgggatttgcacttcgctgattacttt
gcggaagatctcaagctgctcgccccgttagcaaaagatgggctggtggatgtggatgag
aagggaatacaggtgacggcgaaaggtcgcttgctgatccgcaacatttgcatgtgcttt
gatacctatctgcgccagaaagcgcggatgcagcagttctctcgggtgatttaa

DBGET integrated database retrieval system