KEGG   Escherichia coli K-12 DH10B: ECDH10B_4548Help
Entry
ECDH10B_4548      CDS       T00666                                 

Gene name
nadR
Definition
(GenBank) NadR transcriptional repressor / ribosylnicotinamide kinase / NMN adenylyltransferase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00760  Nicotinate and nicotinamide metabolism
ecd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECDH10B_4548 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecd03000]
    ECDH10B_4548 (nadR)
Enzymes [BR:ecd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     ECDH10B_4548 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     ECDH10B_4548 (nadR)
Transcription factors [BR:ecd03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    ECDH10B_4548 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 Citrate_ly_lig HTH_26 CTP_transf_like MMR_HSR1 FAD_syn HTH_37 ABC_tran AAA_29 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ACB05318
Position
4671800..4673032
Genome map
AA seq 410 aa AA seqDB search
MSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFP
RQKKTIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGFDDTRDRALFEDSAMSQQPTV
PDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKKFMAEKGIQPDLIYTSEE
ADAPQYMEHLGIETVLVDPKRTFMSISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVREMMGEQR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcatttgattacctgaaaactgccatcaagcaacagggctgcacgctacagcag
gtagctgatgccagcggtatgaccaaagggtatttaagccagttactgaatgccaaaatc
aaaagccccagcgcgcaaaagctggaggcgttgcaccgttttttggggcttgagtttccc
cggcagaagaaaacgatcggtgtcgtattcggtaagttctacccactgcataccggacat
atctaccttatccagcgcgcctgtagccaggttgacgagctgcatatcattatgggtttt
gacgatacccgtgaccgcgcgttgttcgaagacagtgccatgtcgcagcagccgaccgtg
ccggatcgtctgcgttggttattgcaaacttttaaatatcagaaaaatattcgcattcat
gctttcaacgaagagggcatggagccgtatccgcacggctgggatgtgtggagcaacggc
atcaaaaagtttatggctgaaaaagggatccagccggatctgatctacacctcggaagaa
gccgatgcgccacagtatatggaacatctggggatcgagacggtgctggtcgatccgaaa
cgtacctttatgagtatcagcggtgcgcagatccgcgaaaacccgttccgctactgggaa
tatattcctaccgaagtgaagccgttttttgtgcgtaccgtggcgatccttggcggcgag
tcgagcggtaaatccaccctggtaaacaaacttgccaatatcttcaacaccaccagtgcg
tgggaatatggccgcgattatgtcttttcacacctcggcggtgatgagatcgcattgcag
tattctgactacgataaaatcgcgctgggccacgctcaatacattgattttgcggtgaaa
tatgccaataaagtggcatttatcgataccgattttgtcaccactcaggcgttctgcaaa
aagtacgaagggcgggaacatccgttcgtgcaggcgctgattgatgaataccgtttcgat
ctggtgatcctgctggagaacaacacgccgtgggtggcggatggtttacgcagcctcggc
agttcggtggatcgcaaagagttccagaacttgctggtggagatgctcgaagagaacaat
atcgaatttgtgcgggttgaagaggaagattacgacagtcgtttcctgcgctgcgtggaa
ctggtgcgggagatgatgggggagcagagataa

DBGET integrated database retrieval system