KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z0038Help
Entry
Z0038             CDS       T00044                                 

Gene name
carB
Definition
(GenBank) carbamoyl-phosphate synthase large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00240  Pyrimidine metabolism
ece00250  Alanine, aspartate and glutamate metabolism
ece01100  Metabolic pathways
Module
ece_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ece00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Z0038 (carB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Z0038 (carB)
Enzymes [BR:ece01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     Z0038 (carB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS ATP-grasp ATPgrasp_Ter ATP-grasp_3 ATP-grasp_4 SmpA_OmlA
Motif
Other DBs
NCBI-ProteinID: AAG54335
UniProt: P63737
Structure
PDB: 

Position
35192..38413
Genome map
AA seq 1073 aa AA seqDB search
MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNSNPATIMTDPEM
ADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELERQGVLEEFGVTMIGATA
DAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVGFPCIIRPSFTMGGSGGG
IAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAM
GIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFAVNPKNGRLIVIEM
NPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDITGGRTPASFEPSIDYVVTKIP
RFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKALRGLEVGATGFDPKVSLDDPEA
LTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNIDRWFLVQIEELVRLEEKVAEVG
ITGLNAEFLRQLKRKGFADARLAKLAGVREAEIRKLRDQYDLHPVYKRVDTCAAEFATDT
AYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGIEFDYCCVHASLALREDGYETIMVN
CNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKPKGVIVQYGGQTPLKLARALEAAGVP
VIGTSPDAIDRAEDRERFQHAVDRLKLKQPANATVTAIEMAVEKAKEIGYPLVVRPSYVL
GGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLDHFLDDAVEVDVDAICDGEMVLIGGIME
HIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLI
EVNPRAARTVPFVSKATGVPLAKVAARVMAGKSLAEQGVTKEVIPPYYSVKEVVLPFNKF
PGVDPLLGPEMRSTGEVMGVGRTFAEAFAKAQLGSNSTMKKHGRALLSVREGDKERVVDL
AAKLLKQGFELDATHGTAIVLGEAGINPRLVNKVHEGRPHIQDRIKNGEYTYIINTTSGR
RAIEDSRVIRRSALQYKVHYDTTLNGGFATAMALNADATEKVISVQEMHAQIK
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacgtacagatataaaaagtatcctgattctgggtgcgggcccgattgttatc
ggtcaggcgtgtgagtttgactactctggcgcgcaagcatgtaaagccctgcgcgaagag
ggttaccgcgtcattctggtgaactccaacccggcgaccatcatgaccgacccggaaatg
gccgatgcgacctacatcgagccgattcactgggaagtggtacgtaagattattgaaaaa
gagcgcccggacgcggtgctgccaaccatgggcggtcagacggcgctgaactgcgcgctg
gagctggaacgtcagggcgtgttggaagagttcggcgtcaccatgattggtgccactgcc
gatgcgattgataaagcagaagaccgccgtcgtttcgacgtagcgatgaagaaaattggt
ctggaaaccgcgcgttccggtatcgcacatacgatggaagaagcgctggcggttgccgct
gacgtgggcttcccgtgcattattcgcccatcctttaccatgggcggtagcggcggcggt
atcgcttataaccgcgaagagtttgaagaaatttgcgcccgcggtctggatctctctccg
accaaagagttgctgattgatgagtcgctgatcggctggaaagagtacgagatggaagtg
gtgcgcgataaaaacgacaactgcatcatcgtctgctctatcgaaaactttgatgcgatg
ggcatccacaccggtgactccatcactgtcgcgccagcccaaacgctgaccgacaaagaa
tatcaaatcatgcgtaacgcctcgatggcggtgctgcgtgaaatcggcgttgaaaccggt
ggttccaatgtccagtttgcggtgaacccgaaaaacggtcgcctgattgttatcgaaatg
aacccacgcgtgtcccgttcttcggcgctggcgtcgaaagcgaccggtttcccgattgct
aaagtggcggcgaaactggcggtgggttacaccctcgatgaactgatgaacgacatcact
ggcggacgtactccggcctccttcgagccgtccatcgattacgtggttaccaaaattcct
cgcttcaacttcgaaaaattcgccggtgctaacgaccgtctgaccactcagatgaaatcg
gttggcgaagtgatggcgattggtcgcacgcagcaggaatccctgcaaaaagcgctgcgc
ggcctggaagtcggtgcgactggattcgacccgaaagtgagcctggatgacccggaagcg
ttaaccaaaatccgtcgcgaactgaaagacgcaggcgcagagcgtatctggtacatcgcc
gatgctttccgcgcgggcctgtctgtggacggcgtcttcaacctgactaacattgaccgc
tggttcctggtacagattgaagaactggtgcgtctggaagagaaagtggcggaagtgggc
atcactggcctgaacgctgaattcctgcgccagctgaaacgcaaaggctttgccgatgcg
cgcttggcaaaactggcgggcgtacgcgaagcggaaatccgtaagctgcgtgaccaatat
gacctgcacccggtctacaagcgcgtggatacctgtgcggcagagtttgccaccgacacc
gcttacatgtactccacttatgaagaagagtgcgaagcgaatccgtctaccgaccgtgaa
aaaatcatggtgcttggcggcggtccaaaccgtatcggtcagggtatcgaattcgactac
tgctgcgtacacgcctcgctggcgctgcgtgaagacggttacgaaaccattatggttaac
tgtaacccggaaaccgtctctaccgactacgacacttccgatcgcctctacttcgagccg
gtaactctggaagatgtgctggaaatcgtgcgtattgagaagccgaaaggcgttatcgtt
cagtacggcggtcagaccccgctgaaactggcgcgtgcactggaagccgctggcgtaccg
gttatcggcaccagcccggatgctatcgaccgtgcggaagaccgtgaacgcttccagcat
gcggttgaccgtctgaaactgaaacaaccggcgaacgccaccgttactgctattgaaatg
gcagttgagaaggcaaaagagattggctacccgctggtggtgcgtccgtcttacgttctc
ggcggtcgggcgatggaaatcgtctatgacgaagctgacctgcgtcgctacttccagacg
gcggttagcgtgtctaacgatgcgccagtgttgctggatcatttccttgatgacgcagta
gaagttgacgtggatgccatctgcgacggcgaaatggtgctgattggcggcatcatggag
cacatcgagcaggcgggcgtgcactccggtgactccgcatgttcgctgccagcgtacacc
ttaagtcaggaaattcaggatgtaatgcgccagcaggtgcagaaactggccttcgaattg
caggtgcgcggcctgatgaacgtgcagtttgcggtgaaaaacaacgaagtctacctgatt
gaagttaacccgcgtgcggcgcgtaccgttccgttcgtctccaaagccaccggcgtaccg
ctggcaaaagtggcggcgcgtgtgatggctggcaaatcgctggctgagcagggcgtaacc
aaagaagttatcccgccgtactactcggtgaaagaagtggtgctgccgttcaataaattc
ccgggcgttgacccgctgttagggccagaaatgcgttctaccggggaagtcatgggcgtg
ggccgcaccttcgctgaagcgtttgccaaagcgcagctgggcagcaactccaccatgaag
aaacacggtcgtgcgctgctttccgtgcgcgaaggcgataaagaacgcgtggtggacctg
gcggcaaaactgctgaaacagggcttcgagctggatgcgacccacggcacggcgattgtg
ctgggcgaagcgggtatcaatccgcgtctggtaaacaaggtgcatgaaggccgtccgcac
attcaggaccgtatcaagaatggcgaatatacctacatcatcaacaccacctcaggccgt
cgtgcgattgaagactcccgcgtgatccgtcgcagtgcgctgcaatataaagtgcattat
gacaccaccctgaacggtggtttcgctaccgcgatggcgctgaatgccgatgcgactgaa
aaagtaatttcggtgcaggaaatgcacgcacagatcaaataa

DBGET integrated database retrieval system