KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z0258
Entry
Z0258             CDS       T00044                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Brite
KEGG Orthology (KO) [BR:ece00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ece02044]
    Z0258
Secretion system [BR:ece02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Z0258
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: AAG54527
UniProt: Q8X7U8
Position
complement(256527..257828)
AA seq 433 aa
MIITEQNMPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSVQDRQQSIP
AQAFTVILHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDI
PHYDEEMATPETIVTNRDMLTDTLLSTEGAPHYPGMTHRHQLADTVVNGFSADPLQALQS
ESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDHNDDISAAEMAQR
HLAVTPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGLLDLQQQRNSLSDKHLRPLE
DNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRVLLD
AFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVY
DRVLREKQREPEA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgataatcacggagcagaatatgccggaagagaaactacagacgctttcattgcaggtc
attaacggcagtgagctggaaagcgggcgggcggcgcgctgtctgttcacacagcaggga
aatgtcggccatgcccccgaatgccactggtcggtacaggatcgtcagcagagcattccg
gcccaggcttttaccgttatcctgcacgatggcacattttgtctacgcccgcagacggca
caactgtggctgaatcaggcaaaagtcacagcaacatcagacctgatacagttgcgccag
ggcgatgagatccagatcggacggctgatggtgagggttcatctgaaccggggagatatt
ccccattacgatgaggaaatggccactcccgaaaccatcgttaccaatcgcgatatgctc
acggataccctgctatcaacggagggtgcgccacactatccgggaatgactcaccggcac
cagcttgcagacaccgtggtaaatggtttttctgccgatccactccaggcacttcagtcc
gaaagcctgattaccacgggcgatccgctttcaggcattgcggctgtccggccatcggca
ccgctgtccgatccggcaagtaatggggggatcaatactccgtttatggatctgccgccc
atttatgccagccctggcgatcataatgatgacatctctgcggcagaaatggcgcaacgc
caccttgcggtcacccccttactgcgcggtcttggcggctcgcttaccgtgagcaattcc
gacgatgcggatgattttctggaggaggccggacgaacgttacaggccgcaataaaaggt
ctgctcgatttgcagcagcagcgtaacagcctctcagacaaacatttgcgcccgctggaa
gataacccgctgcgcctgaacatggattacgccaccgcgctcgacgtgatgtttgccgaa
ggtaaaagcccggtacatctggcggctcccgccgccgtcagtgaaagcctgcgcaatgtc
cgccaccacgaagaagctaaccgggcggcgattgtggagtcgcttcgtgtcctgctggat
gctttctcaccacaaaatctgctgcgccgctttgtgcagtaccgccgcagccatgaactg
cgccagccgctggatgatgccggagcatggcaaatgtacagccattattacgaagaactg
gcctccgatcgccagcaggggtttgagatgctgtttaacgaggtctacgcccaggtctat
gaccgggtgcttcgtgaaaaacagcgggagccggaagcatga

DBGET integrated database retrieval system