KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z0266Help
Entry
Z0266             CDS       T00044                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ece00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Z0266
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ece02044]
    Z0266
Secretion system [BR:ece02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Z0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP SBBP
Motif
Other DBs
NCBI-ProteinID: AAG54535
UniProt: A0A4Q2TZM5
Position
264134..264652
Genome map
AA seq 172 aa AA seqDB search
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPA
GQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTI
VDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaccgtgttatatctccatcactggtcagacccagggaaatattactgcaggt
gcatttaccgctgattctgtcggcaacatctatgtgcaggggcacgaagacgagatgctg
gtgcaggaattcctgcataacgttactgtcccgaccgatcctcagtccggtcagcctgcg
ggtcagcgtgctcacaagcctttcatttttaccgtggcgctgaacaaagcggttccgctg
atgtacaacgcactggcctccggcgaaatgctgccaaccactgaacttcactggtggcgt
acctctgtggaaggcaaacaggagcattatttcactacccgcctgactgattcgacgatt
gtcgatatgaaactgcatatgccgcattgccaggacccggcgaaacgcgagttcacccag
ttgctcgaagtttcactggcctaccgcaaaattgaatgggaacacgtcaaatctggcacc
tccggtgccgacgactggcgcgcaccgctggaagcataa

DBGET integrated database retrieval system