KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z0708Help
Entry
Z0708             CDS       T00044                                 

Gene name
ybcZ
Definition
(GenBank) putative 2-component sensor protein
  KO
K07644  two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC:2.7.13.3]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ece00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Z0708 (ybcZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ece01001]
    Z0708 (ybcZ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ece02022]
    Z0708 (ybcZ)
   01504 Antimicrobial resistance genes [BR:ece01504]
    Z0708 (ybcZ)
Enzymes [BR:ece01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Z0708 (ybcZ)
Protein kinases [BR:ece01001]
 Histidine kinases
  OmpR family
   Z0708 (ybcZ)
Two-component system [BR:ece02022]
 OmpR family
  CusS-CusR (copper tolerance)
   Z0708 (ybcZ)
Antimicrobial resistance genes [BR:ece01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    Z0708 (ybcZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AAG54903
UniProt: Q8XBY4
Structure
PDB: 

Position
complement(675764..677212)
Genome map
AA seq 482 aa AA seqDB search
MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAEQDINDLKEISATLER
VLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGAPDIREFARDAIPDKDA
RGGEVFLLSGPTMMMPGHGHGHMEHSNWRMISLPVGPLVDGKPIYTLYIALSIDFHLHYI
NDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQNITSKDLDVRLDPQTVPIE
LEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLITQTEIALSQSRSQKELEDV
LYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLADEVGKVFDFFEALAEDRGVEL
QFVGDECQVAGDPLMLRRALSNLLSNALRYTPPGEAIVVRCQTVDHLVQVIVENPGTPIA
PEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSNARGTRFVIVLPE
RG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggtcagtaagccatttcagcgcccgttttcgctggcaacccgcctgaccttttttatc
agcctggccaccatcgcggcgtttttcgcctttgcatggatcatgatccactcagtaaaa
gtgcattttgccgagcaggatattaatgatttaaaagagattagtgccacccttgaacgc
gtactaaatcaccctgacgaaacgcaagcccgacgcttaatgacgctggaagatatcgtc
agtggttattccaatgtgttgatttccctggcagatagccacggtaaaacggtgtatcac
tcccccggtgcgcctgatatccgcgagtttgcgcgcgatgccatacccgataaagacgcg
cggggcggcgaggtgtttctcctctccggcccgacgatgatgatgccaggccacggtcac
gggcatatggaacacagcaactggcggatgatcagtttgccagttggcccactggttgac
ggcaaaccgatttatacgctctacatcgcgctttcgatcgattttcatcttcattacata
aatgatttgatgaataaacttattatgaccgcatcggtcatcagcatcctgatcgtcttt
atcgtgctattggcggttcataaaggtcacgcgccgatccgcagcgtcagccgtcaaatc
cagaatatcacctcgaaagatctcgacgtccgccttgacccgcagaccgtgccgattgag
ctggaacagctggtactgtcgttcaaccatatgatcgagcgtattgaggatgtctttacc
cgccagtccaatttctcagcggatatcgcccacgaaattcgcacaccaattactaatctc
ataacgcaaacggaaatcgccctcagccagtcgcgcagccagaaggagctggaagatgtg
ctctactctaatctcgaagagctgacgcgaatggcgaaaatggtcagcgatatgctgttt
ctcgcccaggccgataacaaccagttaatccccgaaaagaaaatgctcaacctggcggat
gaagtcggcaaagtgttcgattttttcgaggctttagcggaagatcgcggcgtggagctg
cagtttgttggcgacgagtgccaggttgcgggcgatccgctgatgctgcgtcgggcgtta
agcaacctgctttcgaacgccctgcgttatacgccacccggagaggctattgtagtgcgc
tgccagacggtcgatcatctggtgcaagttatcgtcgaaaaccccggtacgcccattgcg
cccgagcacttaccgcgattgtttgaccgtttctaccgcgttgacccctcccgccaacga
aaaggcgaaggtagcggcattgggctggcgatagtgaaatcaattgttgtcgcgcataaa
ggcacggttgcggttacgtcaaatgcgcgggggacaaggtttgtgattgtgttgccggag
agggggtga

DBGET integrated database retrieval system