KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z0906
Entry
Z0906             CDS       T00044                                 

Symbol
tolR
Name
(GenBank) putative inner membrane protein, involved in the tonB-independent uptake of group A colicins
  KO
K03560  biopolymer transport protein TolR
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Brite
KEGG Orthology (KO) [BR:ece00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ece02000]
    Z0906 (tolR)
Transporters [BR:ece02000]
 Other transporters
  Pores ion channels [TC:1]
   Z0906 (tolR)
SSDB
Motif
Pfam: ExbD
Other DBs
NCBI-ProteinID: AAG55074
UniProt: P0ABV8
Structure
PDB: 
5BY4

Position
862009..862437
AA seq 142 aa
MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEVDLPDATESQAVSSND
NPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPKTVFLIGGAKDVPYDEI
IKALNLLHSAGVKSVGLMTQPI
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccagagcgcgtggacgaggtcgtcgcgatctcaagtccgaaatcaacattgtaccg
ttgctggacgtactgctggtgctgttgctgatctttatggcgacagcgcccatcatcacc
cagagcgtggaggtcgatttgccagacgctactgaatcacaggcggtgagcagtaacgat
aatccgccagtgattgttgaagtgtctggtattggtcagtacaccgtggtggttgagaaa
gatcgcctggagcgtttaccaccagagcaggtggtggcggaagtgtccagccgtttcaag
gccaacccgaaaacggtctttctgatcggtggcgcaaaagatgtgccttacgatgaaata
attaaagcactgaacttgttacatagtgcgggtgtgaaatcggttggtttaatgacgcag
cctatctaa

DBGET integrated database retrieval system