KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z1104Help
Entry
Z1104             CDS       T00044                                 

Gene name
ybjU
Definition
(GenBank) putative arylsulfatase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00260  Glycine, serine and threonine metabolism
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
ece01120  Microbial metabolism in diverse environments
ece01130  Biosynthesis of antibiotics
ece01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ece00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Z1104 (ybjU)
Enzymes [BR:ece01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Z1104 (ybjU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP CheD
Motif
Other DBs
NCBI-ProteinID: AAG55252
UniProt: P58319
Structure
PDB: 

Position
complement(1041065..1042066)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVAXLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKDAWEFTRERNLALHVDGARIFNAVVAYGSE
LKELTQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMY
ALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSREQLAEVAAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgtaacccgaccgagccgcgccatgctcgaagcgatg
atggccgccccggttggggacgacgtttacggagacgaccctaccgttaatgctctgcag
gactatgcagcagagctttccggtaaagaagccgccatttttctgcctaccggcactcag
gccaacctggtcgctstgctcagtcactgcgaacgcggcgaagagtatattgtcggtcag
gccgcgcataactatctgtttgaagccggtggcgcggcggtgctgggcagtattcaaccg
caacccatcgacgcggctgccgacggcacgctaccgctggataaagtggcgatgaaaatc
aaacccgacgatatccatttcgcccgcaccaaattactcagtctggaaaacacccacaac
ggcaaagtgttgccgcgtgaataccttaaagatgcatgggaatttacccgcgagcgcaat
ctggcgctgcatgttgacggtgcgcgcatctttaatgccgtggtggcttacggcagcgaa
ctgaaagagctcacgcaatattgtgattcgttcaccatttgcctgtcgaaaggtcttggg
acgccagtcggttcattactcgtcggtaatcgtgattacattaaacgtgccattcgctgg
cggaaaatgacaggtggcgggatgcgccagtccggcattctggctgccgccgggatgtat
gcgctgaaaaataacgtcgcacggttgcaggaagatcacgacaacgccgcctggatggcg
gagcaactgcgtgaagcaggcgcggatgtgatgcgtcaggacactaatatgctgtttgtt
cgcgtcggcgaagaaaatgctgccgcgttaggcgaatacatgaaagcgagaaacgtactg
attaacgcctcgccgattgtccgcctggtgacccatcttgacgtctcgcgcgaacaactg
gcagaagtcgccgcccactggcgcgcattcctggcgcgttaa

DBGET integrated database retrieval system