KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z1306
Entry
Z1306             CDS       T00044                                 

Gene name
ycbG
Definition
(GenBank) putative dehydrogenase
  KO
K09911  uncharacterized protein
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Brite
KEGG Orthology (KO) [BR:ece00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Z1306 (ycbG)
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: AAG55442
UniProt: P0A8N1
Structure
PDB: 
4D8J

Position
1237179..1237631
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDVLLSLENEPVLVNGWIDK
HMNPELVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFIVWQRLAGLAQRRGKTLSETIV
QLIEDAENKEKYANKMSSLKQDLQALLGKE
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatcttgaaagcggttggaaatggaagtatctggtgaag
aagcatcgcgaaggggagttaatcacccgttacatagaagccagtgccgcccaggaagcc
gtcgatgtgttgctctcgctggaaaatgaacccgtgctggtaaatggctggattgacaag
catatgaatccggaactggtcaatcgcatgaagcaaaccattcgggcaagacgaaagcgc
cattttaatgcggaacaccagcatacgcgcaaaaaatcgatcgatctggaatttattgtc
tggcaacgtctggctggtcttgcgcagcgtcgcggtaaaacgctttctgaaacgattgtt
cagctgattgaagatgcggaaaacaaagagaaatacgcgaataaaatgtcttctctgaag
caggatctgcaggcattgctgggtaaggaataa

DBGET integrated database retrieval system