KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z2594
Entry
Z2594             CDS       T00044                                 

Name
(GenBank) possible chaperone
  KO
K11743  spermidine export protein MdtJ
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Brite
KEGG Orthology (KO) [BR:ece00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ece02000]
    Z2594
Transporters [BR:ece02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Z2594
SSDB
Motif
Pfam: Multi_Drug_Res TgpA_N EamA DUF6057 UPF0060
Other DBs
NCBI-ProteinID: AAG56587
UniProt: P69213
Position
complement(2348223..2348588)
AA seq 121 aa
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA
YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA
V
NT seq 366 nt   +upstreamnt  +downstreamnt
atgtatatttattggattttattaggtctggctattgctacagaaattaccggtacgctg
tctatgaaatgggcgagcgtcagtgagggaaatggcggctttattttaatgctggtgatg
atttctctgtcgtatatatttctctctttcgctgttaaaaaaatagccttaggtgtggct
tatgcgctgtgggaaggtatcggtattttatttattaccttgtttagcgttttgttattc
gacgaaagtttatcgctgatgaaaattgccgggttaaccaccctggtcgccgggatagtg
ttgatcaaatcaggtacccgtaaagcacgtaaacctgaactggaggtgaaccatggcgca
gtttga

DBGET integrated database retrieval system