KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z3206Help
Entry
Z3206             CDS       T00044                                 

Definition
(GenBank) putative UDP-galactose 4-epimerase
  KO
K19997  GlcNAc-P-P-Und epimerase [EC:5.1.3.26]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Brite
KEGG Orthology (KO) [BR:ece00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Z3206
Enzymes [BR:ece01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.26  N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase
     Z3206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-ProteinID: AAG57102
UniProt: Q8X7P7
Position
complement(2858943..2859938)
Genome map
AA seq 331 aa AA seqDB search
MNDNVLLIGASGFVGTRLLETAIADFNIKNLDKQQSHFYPEITQIGDVRDQQALDQALAG
FDTVVLLAAEHRDDVSPTSLYYDVNVQGTRNVLAAMEKNGVKNIIFTSSVAVYGLNKHNP
DENHPHDPFNHYGKSKWQAEEVLREWYNKAPTERSLTIIRPTVIFGERNRGNVYNLLKQI
AGGKFMMVGAGTNYKSMAYVGNIVEFIKYKLKNVAAGYEVYNYVDKPDLNMNQLVAEVEQ
SLNKKIPSMHLPYPLGMLGGYCFDILSKITGKKYAVSSVRVKKFCATTQFDATKVHSSGF
VAPYTLSQGLDRTLQYEFVHAKKDDITFVSE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataacgttttgctcataggagcttccggattcgtaggaacccgactacttgaa
acggcaattgctgactttaatatcaagaacctggacaaacagcagagccacttttatcca
gaaatcacacagattggtgatgttcgtgatcaacaggcactcgaccaggcgttagccggt
tttgacactgttgtactactggcagcggaacaccgcgatgacgtcagccctacttctctc
tattatgatgtcaacgttcagggtacccgcaatgtgctggcggccatggaaaaaaatggc
gttaaaaatatcatctttaccagttccgttgctgtttatggtttgaacaaacacaaccct
gacgaaaaccatccacacgaccctttcaaccactacggcaaaagcaagtggcaggcggag
gaagtgctgcgtgaatggtataacaaagcaccaacagaacgttcattaactatcatccgt
cctaccgttatcttcggtgaacgcaaccgcggtaacgtctataacttgctgaaacagatc
gctggcggcaagtttatgatggtgggcgcagggactaactataagtccatggcttatgtt
ggaaacattgttgagtttatcaagtacaaactgaagaatgttgccgcaggttacgaggtt
tataactacgttgataagccagacctgaacatgaaccagttggttgctgaagttgaacaa
agcctgaacaaaaagatcccttctatgcacttgccttacccactaggaatgctgggtgga
tattgctttgatatcctgagcaaaattacgggcaaaaaatacgctgtcagctctgtgcgc
gtgaaaaaattctgcgcaacaacacagtttgacgcaacgaaagtgcattcttcaggtttt
gtggcaccgtatacgctgtcgcaaggtctggatcgaactctgcagtatgaattcgtccat
gccaaaaaagacgacataacgtttgtttctgagtaa

DBGET integrated database retrieval system