KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z3473Help
Entry
Z3473             CDS       T00044                                 

Gene name
ompC
Definition
(GenBank) outer membrane protein 1b (Ib;c)
  KO
K09475  outer membrane pore protein C
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece01501  beta-Lactam resistance
ece02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ece00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Z3473 (ompC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Z3473 (ompC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ece02000]
    Z3473 (ompC)
Transporters [BR:ece02000]
 Other transporters
  Pores ion channels [TC:1]
   Z3473 (ompC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_1 Porin_4 DUF4912
Motif
Other DBs
NCBI-ProteinID: AAG57350
UniProt: Q8XE41
Structure
PDB: 

Position
complement(3115902..3117005)
Genome map
AA seq 367 aa AA seqDB search
MKVKVLSLLVPALLVAGAANAAEVYNKDGNKLDLYGKVDGLHYFSDDKSVDGDQTYMRLG
FKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYD
VTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGSVSGE
GMTNNGREALRQNGDGVGGSITYDYEGFGIGAAVSSSKRTDDQNSPLYIGNGDRAETYTG
GLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGK
NLGVINGRNYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVA
LGLVYQF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaagtactgtccctcctggtcccagctctgctggtagcaggcgcagcaaac
gctgctgaagtttacaacaaagacggcaacaaattagatctgtacggtaaagtagacggc
ctgcactatttctctgacgacaagtctgtagatggcgaccagacctacatgcgtcttggc
ttcaaaggtgaaactcaggttactgaccagctgaccggttacggccagtgggaatatcag
atccagggcaacagcgctgaaaacgaaaacaactcctggacccgtgtggcattcgcaggt
ctgaaattccaggatgtaggttctttcgactacggtcgtaactacggcgtagtttacgac
gtaacttcctggaccgacgttctgccagaattcggtggtgacacctacggttctgacaac
ttcatgcagcagcgtggtaacggtttcgcgacctaccgtaacactgacttcttcggtctg
gttgacggcctgaactttgctgttcagtaccagggcaaaaacggtagcgtaagcggcgaa
ggcatgactaacaacggtcgtgaagcactgcgtcagaacggcgacggcgttggcggatct
atcacttatgattacgaaggcttcggtatcggtgctgcagtttccagctccaaacgtact
gatgatcagaacagcccgctgtacatcggtaacggcgaccgtgctgaaacctacactggt
ggtctgaaatacgacgctaacaacatctatctggctgctcagtacacccagacctacaac
gcaactcgcgtaggttccctgggttgggcgaacaaagcacagaacttcgaagctgttgct
cagtaccagttcgacttcggtctgcgtccgtccctggcttacctgcagtctaaaggtaaa
aacctgggtgtcatcaatggtcgtaactacgacgacgaagatatcctgaaatatgttgat
gttggcgcgacctactacttcaacaaaaacatgtccacctatgttgactacaaaatcaac
ctgctggacgacaaccagttcactcgtgacgctggcatcaacactgataacatcgtagct
ctgggtctggtttaccagttctaa

DBGET integrated database retrieval system