KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z4094Help
Entry
Z4094             CDS       T00044                                 

Gene name
eno
Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00010  Glycolysis / Gluconeogenesis
ece00680  Methane metabolism
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
ece01120  Microbial metabolism in diverse environments
ece01130  Biosynthesis of antibiotics
ece01200  Carbon metabolism
ece01230  Biosynthesis of amino acids
ece03018  RNA degradation
Module
ece_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ece_M00002  Glycolysis, core module involving three-carbon compounds
ece_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
ece_M00394  RNA degradosome
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Z4094 (eno)
  Energy metabolism
   00680 Methane metabolism
    Z4094 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Z4094 (eno)
Enzymes [BR:ece01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Z4094 (eno)
Messenger RNA biogenesis [BR:ece03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Z4094 (eno)
Exosome [BR:ece04147]
 Exosomal proteins
  Proteins found in most exosomes
   Z4094 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: AAG57892
UniProt: P0A6Q1
Structure
PDB: 

Position
complement(3696340..3697638)
Genome map
AA seq 432 aa AA seqDB search
MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAK
AAAAAKGMPLYEHIAELNGTPGKXSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVK
EAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD
ITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDG
FAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAK
DAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKA
PYNGRKEIKGQA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcgtaaaaatcatcggtcgtgaaatcatcgactcccgtggtaacccgact
gttgaagccgaagtacatctggagggtggtttcgtcggtatggcagctgctccgtcaggt
gcttctactggttcccgtgaagctctggaactgcgcgatggcgacaaatcccgtttcctg
ggtaaaggcgtaaccaaagctgttgctgcggtaaacggcccgatcgctcaggcgctgatt
ggcaaagatgctaaagatcaggctggcattgacaagatcatgatcgacctggacggcacc
gaaaacaaatccaaattcggcgcgaacgcaatcctggctgtatctctggctaacgccaaa
gctgctgcagctgctaaaggtatgccgctgtacgagcacatcgctgaactgaacggcact
ccgggcaaawamtccatgccggttccgatgatgaacatcatcaacggtggtgagcacgct
gacaacaacgttgatatccaggaattcatgattcagccggttggcgcgaaaactgtgaaa
gaagccatccgcatgggttctgaagttttccatcacctggcaaaagttctgaaagcgaaa
ggcatgaacactgctgttggtgacgaaggtggctatgcgccgaacctgggttccaacgct
gaagctctggctgttatcgctgaagctgttaaagctgctggttatgaactgggcaaagac
atcactctggcgatggactgcgcagcttctgaattctacaaagacggtaaatacgttctg
gctggcgaaggcaacaaagcattcacctctgaagaattcactcacttcctggaagaactg
accaaacagtacccgatcgtttccatcgaagacggtctggacgaatctgactgggatggt
ttcgcataccagaccaaagttctgggcgacaaaatccagctggttggtgacgacctgttc
gtaaccaacaccaagatcctgaaagaaggtatcgaaaaaggtatcgctaactccatcctg
atcaaattcaaccagatcggttctctgaccgaaactctggctgcaatcaagatggcgaaa
gacgctggctacactgcagttatctctcaccgttctggcgaaactgaagacgctaccatc
gctgacctggctgttggtactgctgcaggccagatcaaaactggttctatgagccgttct
gaccgcgttgctaaatacaaccagctgattcgtatcgaagaagctctgggcgaaaaagca
ccgtacaacggtcgtaaagagatcaaaggccaggcataa

DBGET integrated database retrieval system