KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z4164Help
Entry
Z4164             CDS       T00044                                 

Gene name
yqeF
Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00071  Fatty acid degradation
ece00280  Valine, leucine and isoleucine degradation
ece00310  Lysine degradation
ece00362  Benzoate degradation
ece00380  Tryptophan metabolism
ece00620  Pyruvate metabolism
ece00630  Glyoxylate and dicarboxylate metabolism
ece00640  Propanoate metabolism
ece00650  Butanoate metabolism
ece00900  Terpenoid backbone biosynthesis
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
ece01120  Microbial metabolism in diverse environments
ece01130  Biosynthesis of antibiotics
ece01200  Carbon metabolism
ece01212  Fatty acid metabolism
ece02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ece00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Z4164 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    Z4164 (yqeF)
   00640 Propanoate metabolism
    Z4164 (yqeF)
   00650 Butanoate metabolism
    Z4164 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Z4164 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    Z4164 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Z4164 (yqeF)
   00310 Lysine degradation
    Z4164 (yqeF)
   00380 Tryptophan metabolism
    Z4164 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Z4164 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Z4164 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Z4164 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ece04147]
    Z4164 (yqeF)
Enzymes [BR:ece01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Z4164 (yqeF)
Exosome [BR:ece04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Z4164 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: AAG57956
UniProt: A0A0H3JI11
Position
complement(3774111..3775295)
Genome map
AA seq 394 aa AA seqDB search
MMKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTA
GAGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMS
RAPHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYA
LSSQQKARAAIDAGRFKDEIVPVMTQSNGQTLVVDTDEQPHTDASAEGLARLNPSFDSLG
SVTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRC
LERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILV
SLVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgcggt
gcgttagcgggtcattccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaa
cgtaccggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgca
ggggcagggcagaatccggcaaggcaatcggctattaaaggtggtctgcctaatagcgtt
tctgcaatcacgattaatgacgtctgcggttccgggcttaaagcactgcatctggctact
caggcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagc
cgcgcaccacatgttctgactgatagccgcaccggtgcacagcttggcaatagccagctg
gttgacagtcttgtgcatgatgggttatgggatgccttcaatgattatcatattggtgtc
accgccgaaaatctggctcgcgaatatggcatcagccgtcaattgcaggatgcttacgca
cttagctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatc
gtcccggtaatgacccaaagtaacggtcagacgttggttgttgataccgatgaacagcca
cacactgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggt
tctgtgacagcgggtaatgcatcatccataaacgatggcgcagctgcggtaatgatgatg
agcgaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgcc
agcgttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgc
ctggagcgtgtaggctggcagttggctgatgttgatcttatcgaggctaatgaagcgttt
gctgcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtc
aatggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtt
tctctggttcatgaaatggtgaaacgtaatgcccgcaaaggactggcaacgctttgtatc
ggcgggggccagggtgtggcattgaccattgaacgtgacgaatag

DBGET integrated database retrieval system