KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z4207
Entry
Z4207             CDS       T00044                                 

Definition
(GenBank) putative dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00230  Purine metabolism
ece01100  Metabolic pathways
ece01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ece00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Z4207
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AAG57997
UniProt: Q8X6C4
Position
3809126..3809605
AA seq 159 aa
MNHSETITIECTINGMPFQLHAVPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
catgccgtaccaggcacgccgctytcggaattactccgcgaacaagggctgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system