KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5100
Entry
Z5100             CDS       T00044                                 

Symbol
espF
Name
(GenBank) espF
  KO
K12786  LEE-encoded effector EspF
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece05130  Pathogenic Escherichia coli infection
Module
ece_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:ece00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    Z5100 (espF)
SSDB
Motif
Pfam: EspF
Other DBs
NCBI-ProteinID: AAG58814
UniProt: A0A4P8B4C9
Position
complement(4658240..4658986)
AA seq 248 aa
MLNGISNAASTLGRQLVGIASRVSSAGGTGFSVAPQAVRLTPVKVHSPFSPGSSNVNART
IFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKP
ARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQA
SGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTGPSGLPPLAQALKDHLA
AYEQSKKG
NT seq 747 nt   +upstreamnt  +downstreamnt
atgcttaatggaattagtaacgctgcttctacactagggcggcagcttgtaggtatcgca
agtcgagtgagctctgcggggggaactggattttctgtagcccctcaggccgtgcgtctt
actccggtgaaagttcattcccctttttctccaggctcgtcgaatgttaatgcgagaacg
atttttaatgtgagcagccaggtgacttcatttactccctctcgtccggcaccgccgcca
ccgacaagtggacaggcatccggggcatcccgacctttaccgcccattgcacaggcatta
aaagagcacttggctgcctatgaaaaatcgaaaggtcctgaggctttaggttttaagccc
gcccgtcaggcaccgccgccaccgacaagtggacaggcatccggggcatcccgaccttta
ccgcccattgcacaggcattaaaagagcacttggctgcctatgaaaaatcgaaaggtcct
gaggctttaggttttaagcccgcccgtcaggcaccgccgccaccgacaagtggacaggca
tccggggcatcccgacctttaccgcccattgcacaggcattaaaagagcacttggctgcc
tatgaaaaatcgaaaggtcctgaggctttaggttttaagcccgcccgtcaggcaccaccg
ccaccgacagggcctagtggactaccgccccttgcacaggcattaaaagatcatttagct
gcctatgagcaatcgaagaaagggtaa

DBGET integrated database retrieval system