KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5464Help
Entry
Z5464             CDS       T00044                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00010  Glycolysis / Gluconeogenesis
ece00051  Fructose and mannose metabolism
ece00562  Inositol phosphate metabolism
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
ece01120  Microbial metabolism in diverse environments
ece01130  Biosynthesis of antibiotics
ece01200  Carbon metabolism
ece01230  Biosynthesis of amino acids
Module
ece_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ece_M00002  Glycolysis, core module involving three-carbon compounds
ece_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Z5464 (tpiA)
   00051 Fructose and mannose metabolism
    Z5464 (tpiA)
   00562 Inositol phosphate metabolism
    Z5464 (tpiA)
Enzymes [BR:ece01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Z5464 (tpiA)
Exosome [BR:ece04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Z5464 (tpiA)
  Exosomal proteins of bladder cancer cells
   Z5464 (tpiA)
  Exosomal proteins of melanoma cells
   Z5464 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAG59112
UniProt: P0A860
Structure
PDB: 

Position
complement(4979463..4980230)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgtgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggtcactctgaacgtcgtact
taccacaaagaatctgacgaactgatcgcgaaaaaattcgcggtgctgaaagarcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcaratcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcattcgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcgtctctgaaagctgac
gctttcgcagtaatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system