KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5576
Entry
Z5576             CDS       T00044                                 

Symbol
hupA
Name
(GenBank) DNA-binding protein HU-alpha (HU-2)
  KO
K05787  DNA-binding protein HU-alpha
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Brite
KEGG Orthology (KO) [BR:ece00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ece03032]
    Z5576 (hupA)
   03036 Chromosome and associated proteins [BR:ece03036]
    Z5576 (hupA)
   03400 DNA repair and recombination proteins [BR:ece03400]
    Z5576 (hupA)
DNA replication proteins [BR:ece03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Z5576 (hupA)
Chromosome and associated proteins [BR:ece03036]
 Prokaryotic type
  Nucleoid associated proteins
   HU (heat unstable protein)
    Z5576 (hupA)
DNA repair and recombination proteins [BR:ece03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      Z5576 (hupA)
SSDB
Motif
Pfam: Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267
Other DBs
NCBI-ProteinID: AAG59197
UniProt: P0ACF2
Position
5077852..5078124
AA seq 90 aa
MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG
RNPQTGKEIKIAAANVPAFVSGKALKDAVK
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaacaagactcaactgattgatgtaattgcagagaaagcagaactgtccaaaacccag
gctaaagctgctctggagtccactctggctgcaattactgagtctctgaaagaaggcgat
gctgtacaactggttggtttcggtaccttcaaagtgaaccaccgcgctgagcgtactggc
cgcaacccgcagaccggtaaagaaatcaaaattgccgcagctaacgtaccggcatttgtt
tctggcaaggcactgaaagacgcagttaagtaa

DBGET integrated database retrieval system