KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5856Help
Entry
Z5856             CDS       T00044                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase, catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00240  Pyrimidine metabolism
ece00250  Alanine, aspartate and glutamate metabolism
ece01100  Metabolic pathways
Module
ece_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Z5856 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Z5856 (pyrB)
Enzymes [BR:ece01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Z5856 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AAG59443
UniProt: P0A788
Structure
PDB: 

Position
complement(5356983..5357918)
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEXSTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GNVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKF
DGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQAL
LALVLNRDLVL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctatatcagaaacatatcatttccataaacgaccttagtcgcgatgac
cttaatctggtgctggcgacagcggcgaaactgaaagcaaacccgcaaccagagctgttg
aagcacaaagtcattgccagctgtttcttcgaakcctctacccgtacccgcctctctttc
gaaacttccatgcaccgcctgggtgccagcgtggtgggcttctccgacagcgccaataca
tcactgggtaaaaagggcgaaacgctggccgataccatttcggttatcagcacttacgtc
gatgcgatagtgatgcgtcatccgcaggaaggtgcggcgcgcctggccaccgagttttcc
ggcaatgtaccggtactgaatgccggtgatggctccaaccaacatccgacgcaaaccttg
ctggacttattcaccattcaggaaacccaggggcgtctggacaatctccacgtcgcaatg
gttggtgacctgaaatatggccgcaccgttcactccctgactcaggcgttagcgaagttc
gacggcaaccgtttttacttcatcgcgccggacgcgctggcaatgccgcaatacattctg
gatatgcttgatgaaaaagggatcgcatggagtctgcacagctctattgaagaagtgatg
gcggaagttgacatcctgtacatgacccgcgtgcaaaaagagcgtctggacccgtccgag
tacgccaacgtgaaagcgcagtttgttcttcgcgccagcgatctccacaacgccaaagcc
aatatgaaagtacttcatccgctgccgcgtgttgatgagattgcgacggatgttgataaa
acgccacacgcctggtacttccagcaggcaggcaacgggattttcgctcgccaggcgtta
ctggcactggttctgaatcgcgatctggtactgtaa

DBGET integrated database retrieval system