KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0237
Entry
ECH74115_0237     CDS       T00778                                 

Gene name
clpV
Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECH74115_0237 (clpV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecf02044]
    ECH74115_0237 (clpV)
Secretion system [BR:ecf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECH74115_0237 (clpV)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 AAA_16 ClpB_D2-small AAA_22 AAA_7 NACHT RsgA_GTPase TniB AAA_18 AAA_24 Sigma54_activat Rad17 AAA_6 ABC_tran_CTD
Other DBs
NCBI-ProteinID: ACI36719
Position
complement(251110..253881)
AA seq 923 aa
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQG
DIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLA
LLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPDADGKGAGTLTDASDTLL
ARYAKNMTEDARNGRLAPVLCRDHEIDLMIDILCRRRKNNPVVVGEAGVGKSALIEGLAL
RIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLMAEVISSPVPVILFIDEAH
TLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRFQLVKVSEP
NAAEATIILRGLSAVYERSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDEL
EAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESEQDNTGAVPAD
ETDREQPEETAETVSPVQRLAQLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNR
LSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHLLTARADLRRPGRPLGAFLLAGPSGVG
KTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKP
YSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHAD
DPETMQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAE
VVIEPEVTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAVD
GAFTADVEDAQNDESVTKDETVL
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgatccagattgatcttcccacgctggtaaaacggctgaacctgttctcccgccaggcg
ctggagatggccgcctcagaatgtatgagccagcaggcagcggaaattaccgtcagccat
gtgcttattcagatgctcgccatgccacgcagtgacctgcgggttattacccgccagggc
gatattggcatggaagagttgcgccaggcgttgacggtagagaactacacaaccgcccgt
tctgcggacagctacccggcgttttccccgatgctggttgagtggcttaaagagggctgg
ctgctggcgtcggctgagatgcagcacagcgaactgcgcggcggcgtgttgctgctggcc
ttgctgcattcgccgctgcgttatataccgcctgctgccgcccggctgttgaccggcatt
aaccgtgaccgtctgcaacaggactttgtgcagtggacacaggagtcggcggaatcagtc
gtgccggatgcagacggtaaaggcgcaggcacactgacggacgcctctgacaccctgctt
gcccgctacgccaaaaacatgacagaagacgcccgtaacggcaggctagccccagtactg
tgccgcgaccacgaaatcgacctgatgatcgacattctctgccgccgccgtaaaaacaac
ccggtggtggtgggcgaagcaggcgtgggtaaaagcgcgctgattgaagggctggcgctg
cgcatcgtggcaggccaggtgccggacaaactgaaaaacaccgatatcatgacccttgac
ctgggcgcattgcaggccggggcatcggtgaagggtgagtttgaaaaacgcttcaagggg
ctgatggcggaggtcatttcctctccggtgccggtcattctgtttatcgacgaagcgcat
accctgattggcgcgggcaaccagcagggcgggctggatatctccaacctgctgaaaccg
gcgctggcgcgtggcgaactgaaaaccatcgccgccaccacctggagcgagtacaaaaaa
tacttcgagaaagacgccgccctgtcgcgccgcttccagttagtgaaggtcagcgaaccc
aacgctgccgaagccaccattattctgcgtggtctgtcggcggtctatgaacggtctcac
ggcgtgctgattgacgatgatgccttgcaggccgcagcaacgctgagcgaacgttatctc
tccgggcgtcagttaccggacaaagcgattgatgtgctggataccgcctgcgcccgtgtg
gccatcaacctgtcgtcgccgccgaagcaaatctcggcgctgaccactctgagccaccag
caggaggcggaaattcgccagcttgagcgcgagcttcgcatcggactgcgtaccgacaca
tcacggatgaccgaggtgctggtgcagtatgatgaaacgctgacggcgctggatgaactg
gaagcggcttggcaccagcagcagacgctggtccgggagattatcgcgctgcgccagcag
ttactgggcgtggcagaggacgatgcggcgccgttgccggacgcagatactgtggaggat
acgcagccagagtcagagtcagagtcagaacaggataataccggtgccgtaccggctgat
gagaccgacagagaacagccggaagagaccgctgaaacagtttccccggtacagcggctg
gcccagctcactgccgaactggacgccctgcataacgaccggttgctggtctccccgcac
gtcgataaaaaacagattgcggcggtgattgccgaatggaccggcgtgccgctcaaccgc
ctgtcgcagaatgaaatgtcggtcatcaccgacctgccgaaatggctgggcgacaccatc
aaaggccaggacctggcgattgccagcctgcataagcatctactgaccgcacgcgccgac
ctgcgtcgtccgggacgcccgctcggtgcgttcctgctcgctggccccagcggcgtgggt
aaaaccgaaaccgtcctgcaactggcagagctgctctacggcggtcgccagtacctgacc
accatcaatatgtccgagttccaggagaaacacaccgtttcgcggctgattggctcccct
ccgggctatgtcggctatggcgaaggcggcgtgctgactgaagccatccgccagaaaccc
tactcggtggtgctgctcgatgaagtggaaaaagcgcacccggatgtcctcaacctgttc
taccaggcgtttgacaagggcgagatggccgacggcgaaggccgcctgattgactgtaaa
aacatcgtcttcttcctcacctccaacctcggttaccaggtgattgtcgaacacgcggat
gacccggaaaccatgcaggaagccctctatccggtgctggcggacttctttaaacctgcc
ctgctggcgcgaatggaggtggtgccgtacctgccgctgtcgaaagagacgctcgccacc
attatcgccgggaaactggcccgtctggataacgtgctgcgcagtcgctttggtgcagaa
gtggtcattgaaccggaagtgacggacgaaatcatgagccgcgtcacccgcgcggaaaac
ggcgcgaggatgctggaatctgtcatcgatggcgacatgctaccgccgctctcgctgctg
ctgttgcagaaaatggcggctaacacggcgattgcccggattcggttgtcggcagtggac
ggcgcatttacggcagacgtggaagatgctcagaacgacgagtccgtcacaaaggatgaa
acggttttatga

DBGET integrated database retrieval system