KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0242
Entry
ECH74115_0242     CDS       T00778                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecf02044]
    ECH74115_0242
Secretion system [BR:ecf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECH74115_0242
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ACI37711
Position
complement(257816..258898)
AA seq 360 aa
MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAELLHRLAKGEKGTPELS
LRDDPAQETLRFSADASLAFPCSDISALKRDTSGAFRMTTTFMGLQGSQSPLPGYYLDHL
AWKAVHEQSPVGDFLDMFSHRLTQFVWHIWRKYRYHISFRNGGVDAFSQRMYSLVGLGHR
QLRDKLAINHSKMLAYSGILANPGRSPEIICGLVSHCFDLSEVTLQNWQRRKVDIEPDQQ
NSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSITSLTRKQFLSFLPSGENFLP
LTTFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLGWTSFLGTPEERPSVTIRVRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggacggaaagaatcgggcagcatcctcttatctgagtccgggaaatcccccggcagat
aaagagcagaatgatccgctggcacaggttttccataatgcctgctcttacaattttttt
gcgatggcggagctgttgcaccgcctggcaaagggtgaaaaggggacgccagaattatcc
ctgcgcgacgatccggcacaggaaaccctgcgtttcagcgccgatgccagccttgccttc
ccgtgcagtgatatcagtgcgctgaaacgggatacgtcaggggcattcaggatgaccact
acctttatggggttacaggggagccagtcgcctctccccggttattacctcgatcacctg
gcctggaaagcggtacatgaacaaagtccggtaggtgattttctggatatgttcagccac
cgcctgacccagtttgtctggcatatctggcgtaagtaccgctatcacatcagttttcgt
aacggcggtgtggatgcgttctcgcagcgcatgtactcccttgtcgggctgggccaccgc
cagcttcgcgataagctggcgattaatcacagcaaaatgctggcgtattccgggatcctg
gcaaatccgggacgatccccggaaattatctgtggcctggtgtcccactgctttgatttg
tcagaagtgacgctgcaaaactggcaacgtcgcaaggtggatattgaaccggatcagcaa
aacagcctggggagctattctcttaaaaatggcgaaaaactggcgggaagatcggtactg
ggcaactttgttctgggtacacgagtacccgatctcagcggaaaattccagctcagtatt
accagcctgacccgaaaacagttcctctcttttctgccgtccggcgaaaacttcctgcca
ctgacgacgttcgtgtccttcatcctgcgcgatcagcttgcctgggacttacatctgggg
ctggcgccggagcaggtgggcgcaatgcgcctgggcgataacaaaagtgcgctgctgggc
tggaccagcttcctcggcacaccggaagaacgaccctcagtcaccatcagggtacggtcg
taa

DBGET integrated database retrieval system