KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0249
Entry
ECH74115_0249     CDS       T00778                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECH74115_0249
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecf02044]
    ECH74115_0249
Secretion system [BR:ecf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECH74115_0249
SSDB
Motif
Pfam: T6SS_HCP SBBP
Other DBs
NCBI-ProteinID: ACI37554
Position
264118..264636
AA seq 172 aa
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPA
GQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTI
VDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaacaccgtgttatatctccatcactggtcagacccagggaaatattactgcaggt
gcatttaccgctgattctgtcggcaacatctatgtgcaggggcacgaagacgagatgctg
gtgcaggaattcctgcataacgttactgtcccgaccgatcctcagtccggtcagcctgcg
ggtcagcgtgctcacaagcctttcatttttaccgtggcgctgaacaaagcggttccgctg
atgtacaacgcactggcctccggcgaaatgctgccaaccactgaacttcactggtggcgt
acctctgtggaaggcaaacaggagcattatttcactacccgcctgactgattcgacgatt
gtcgatatgaaactgcatatgccgcattgccaggacccggcgaaacgcgagttcacccag
ttgctcgaagtttcactggcctaccgcaaaattgaatgggaacacgtcaaatctggcacc
tccggtgccgacgactggcgcgcaccgctggaagcataa

DBGET integrated database retrieval system