KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0251Help
Entry
ECH74115_0251     CDS       T00778                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECH74115_0251
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecf02044]
    ECH74115_0251
Secretion system [BR:ecf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECH74115_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF1419
Motif
Other DBs
NCBI-ProteinID: ACI38367
Position
264846..266987
Genome map
AA seq 713 aa AA seqDB search
MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLALSLVSQQFLSLEFQQILDKMAYL
TIWQGDDVQRRVKGVVTWFELGENDKNQKLYSMKVCPPLWRTGLRQNFRIFQNEDIASIL
GTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSTDQS
LVLCDTVLYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRPSSVVTKDYTFKRPGWAGR
FDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWRNNAEVARGTSRSPEIWPGR
RIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTTLDNHFAVIPADRTWRPQPLL
KPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQDSSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKTYKGSGFN
ELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQILNIGVN
QIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALTVGVAYQTTVGGIMNTSVALLQSSQ
VGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQTAVYSAGEHLELCCGKARLVLTKDG
SIFLNGTHIHLEGESDVNGDAPVINWNCGATQPVPDAPVPKDLPPGMPDMRQF
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccggattacgtttcacgctggaagtggacggcctgccaccggatgcttttgcg
gtggtctcctttcatctgaaccagtcactctcttcgcttttttccctcgctctctctctg
gtcagccagcagtttctctcccttgaattccagcagatcctcgacaaaatggcctacctg
acgatatggcagggcgatgacgtacagcgccgggtgaaaggtgtggtgacctggtttgaa
ctgggggagaacgacaaaaaccagaagctgtacagcatgaaggtatgcccgccgctgtgg
cgcacagggctgcgccagaacttccgtatcttccagaatgaggacatcgcaagcatcctc
ggcacgatattgcaggaaaacggggtgaccgagtggagcccgctgttcagcgagccacat
ccttcccgtgagttttgtgtccagtacggtgagactgattacgatttcctgtgccggatg
gcggcggaggaaggcatcttcttttatgaggagcacgcgcaaaaaagtaccgaccagagc
ctggtcctgtgcgataccgtgctttatctgccggagtcctttgagatcccctggaatccg
aacacccgtaccgaggtaagcaccctctgcatcagccagtttcgctacagcgcacaaatc
cgcccttcttccgtggtgaccaaagactacacctttaaacgccccggctgggccggacgt
tttgaccaggaaggccagcaccaggattaccagcgcacacagtatgaagtgtatgactat
cccggacgtttcaagggcgcccacgggcagaactttgcccgctggcagatggacggctgg
cgaaacaacgcagaagtggcgcgcggaacaagccgttcgccggagatatggccgggacgg
cgaattgtgctgacggggcatccgcaggcgaacctgaaccgggaatggcaggtggtggca
agtgaactgcacggtgagcagccgcaggcggtgccgggacgcaggggttcaggcaccacg
ctggataaccattttgcggtaataccggcagacagaacatggcgaccacagccgttgctg
aaaccgctggtggacggcccgcagagcgccgtcgtgacgggaccggcaggcgaggaaatc
ttctgtgatgaacatggccgcgtgcgggtgaaatttaactgggaccgctataacccgtca
aaccaggacagttcatgctggatccgtgtggcacaggcgtgggcaggcaccgggtttggt
aacctggcgataccgcgtgtgggtcaggaggtcattgtggacttcctcaacggcgatccg
gaccagccgatcattatggggcgtacctaccaccaggaaaaccgcacacccggtagcctg
ccggggacgaagacgcagatgaccattcgttcgaaaacctataagggcagcgggtttaat
gaactgaagtttgacgatgcgacagggaaagaacaggtctacatccacgcgcagaagaac
atgaacaccgaggtgctgaataaccgcaccacggatgtgataaacaaccatgccgaaaaa
ataggtaacaaccaggcgatcaccgttaccaataaccagatcctgaacattggcgttaat
cagatacagacggttggtgtcaaccaggtggaaacggtaggcagtaaccagattatcaaa
gtgggatcaaaccaggttgaaaaggtggggatcattcgtgcgctgacggtgggtgtggcg
tatcagacgacggtaggcggcattatgaatacctcggtggcgttgttgcagtcctcacag
gtagggctgcataaatcactgatggtgggaatgggctacagcgtcaatgtagggaataac
gtcaccttctcggtgggcaagacgatgaaggaaaacaccggacaaacagcagtttattct
gccggtgagcatcttgaactctgctgtggtaaggcaaggctggtgctgacgaaggacgga
agcatatttcttaatggtacgcacattcatctggaaggggagtcggatgtgaacggtgat
gcgccggtgattaactggaactgtggtgccacacaacctgtaccggatgcgcctgtgccg
aaagatttaccccccggaatgccggatatgcggcaattttga

DBGET integrated database retrieval system