KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0505Help
Entry
ECH74115_0505     CDS       T00778                                 

Gene name
xseB
Definition
(GenBank) exodeoxyribonuclease VII, small subunit
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    ECH74115_0505 (xseB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecf03400]
    ECH74115_0505 (xseB)
Enzymes [BR:ecf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     ECH74115_0505 (xseB)
DNA repair and recombination proteins [BR:ecf03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     ECH74115_0505 (xseB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_S
Motif
Other DBs
NCBI-ProteinID: ACI36987
UniProt: B5Z3S7
Position
complement(510740..510982)
Genome map
AA seq 80 aa AA seqDB search
MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAEQRV
QILLSDNEDASLTPFTPDNE
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagaaaaatgaggcgcccgccagctttgaaaaggcgctgagcgagctggaacag
attgtaacccgtctggaaagtggcgacctgccgctggaagaggcgctgaacgagttcgaa
cgcggcgtgcagctggcacgtcaggggcaggccaaattacaacaagccgaacagcgcgta
caaattctgctgtctgacaacgaagacgcctctctaaccccttttacaccggacaatgag
taa

DBGET integrated database retrieval system