KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0857Help
Entry
ECH74115_0857     CDS       T00778                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00010  Glycolysis / Gluconeogenesis
ecf00260  Glycine, serine and threonine metabolism
ecf00680  Methane metabolism
ecf01100  Metabolic pathways
ecf01110  Biosynthesis of secondary metabolites
ecf01120  Microbial metabolism in diverse environments
ecf01130  Biosynthesis of antibiotics
ecf01200  Carbon metabolism
ecf01230  Biosynthesis of amino acids
Module
ecf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecf_M00002  Glycolysis, core module involving three-carbon compounds
ecf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECH74115_0857 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ECH74115_0857 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECH74115_0857 (gpmA)
Enzymes [BR:ecf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECH74115_0857 (gpmA)
Membrane trafficking [BR:ecf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECH74115_0857 (gpmA)
Exosome [BR:ecf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECH74115_0857 (gpmA)
  Exosomal proteins of melanoma cells
   ECH74115_0857 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ACI39667
UniProt: B5YRF2
Structure
PDB: 

Position
complement(874076..874828)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaaatatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtaatc
atcgctgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcagccgttgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system