KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_3594Help
Entry
ECH74115_3594     CDS       T00778                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00052  Galactose metabolism
ecf00500  Starch and sucrose metabolism
ecf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECH74115_3594
   00500 Starch and sucrose metabolism
    ECH74115_3594
Enzymes [BR:ecf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECH74115_3594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: ACI38528
Position
3308531..3309973
Genome map
AA seq 480 aa AA seqDB search
MIKMTQSRLHAAQNALAKLHERRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHH
PMSEHWGPMHWGHATSDDMIHWQHEPIALAPGDENDKDGCFSGSAVDDNGVLSLIYTGHV
WLDGAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGA
KDPGNTGQILLYRGSSLREWTFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNA
EGYSYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFVAKDGRRIVIGWMDM
WESPMPSKREGWAGCMTLARELSESNGKLLQRPVHEAESLRQQHQSISPRTISNKYVLQE
NAQAVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLVLWRYYPHENLDGYRSIPLP
QRDTLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEERELSLYASHGVAVVQHGALWQLG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatgacgcaatctcgattgcatgcggcgcaaaacgcactagcaaaacttcac
gagcgccgaggtaacactttctatccccattttcacctcgcgcctcctgccgggtggatg
aacgatccaaacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcac
ccaatgagtgaacactgggggccaatgcactggggacatgccaccagcgacgatatgatc
cactggcagcatgagcctattgcgctagcgccaggagacgagaatgacaaagatgggtgt
ttttcaggtagtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtc
tggctcgatggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagt
cgggatggtattcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatg
cacttccgcgatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcg
aaagacccaggcaacactgggcagatcctgctttatcgcggcagttcattacgtgaatgg
actttcgatcgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccg
gactttttcagccttggcgatcagcattatctgatgttttccccgcagggaatgaatgcc
gagggatacagttaccgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgcca
ggacgactttttgcacaatccgggcattttactgaacttgataacgggcatgacttttat
gcaccacaaagctttgtagcgaaggatggtcggcgtattgttatcggctggatggatatg
tgggaatcgccaatgccctcaaaacgtgaaggctgggcaggctgcatgacgctggcgcgc
gagctatcagagagcaatggcaaacttctacaacgcccggtacacgaagctgagtcgtta
cgccagcagcatcaatctatctctccccgcacaatcagcaataaatatgttttgcaggaa
aacgcgcaagcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacat
tacggattacagctcggcactggaatgcggctgtatattgataaccaatctgagcgactt
gttttgtggcggtattacccacacgagaatttagacggctaccgtagtattcccctcccg
cagcgtgacacgctcgccctaaggatatttatcgatacatcatccgtggaagtatttatt
aacgacggggaagcggtgatgagtagtcgaatctatccgcagccagaagaacgggaactg
tcgctttatgcctcccacggagtggctgtggtgcaacatggagcactctggcaactgggt
taa

DBGET integrated database retrieval system