KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_3620Help
Entry
ECH74115_3620     CDS       T00778                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00010  Glycolysis / Gluconeogenesis
ecf00052  Galactose metabolism
ecf00500  Starch and sucrose metabolism
ecf00520  Amino sugar and nucleotide sugar metabolism
ecf00521  Streptomycin biosynthesis
ecf01100  Metabolic pathways
ecf01110  Biosynthesis of secondary metabolites
ecf01120  Microbial metabolism in diverse environments
ecf01130  Biosynthesis of antibiotics
ecf01200  Carbon metabolism
Module
ecf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECH74115_3620 (glk)
   00052 Galactose metabolism
    ECH74115_3620 (glk)
   00500 Starch and sucrose metabolism
    ECH74115_3620 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ECH74115_3620 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECH74115_3620 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ECH74115_3620 (glk)
Enzymes [BR:ecf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECH74115_3620 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ACI36578
UniProt: B5YZU2
Structure
PDB: 

Position
complement(3340711..3341676)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccgattaccggagactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtagaaggtaagcctattgcggtttacggtgccggaacggggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccgggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggaacgcgtgctttctggcccaggactggtgaatttgtatcgc
gcaattgttaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgtgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggcggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system