KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_3743Help
Entry
ECH74115_3743     CDS       T00778                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00230  Purine metabolism
ecf00240  Pyrimidine metabolism
ecf01100  Metabolic pathways
ecf01110  Biosynthesis of secondary metabolites
ecf01130  Biosynthesis of antibiotics
Module
ecf_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ecf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ecf_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
ecf_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECH74115_3743 (ndk)
   00240 Pyrimidine metabolism
    ECH74115_3743 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecf04131]
    ECH74115_3743 (ndk)
Enzymes [BR:ecf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     ECH74115_3743 (ndk)
Membrane trafficking [BR:ecf04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    ECH74115_3743 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ACI38635
UniProt: B5Z0Y7
Structure
PDB: 

Position
complement(3464691..3465122)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF
DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD
SVESAAREIAYFFGEGEVCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaacgtactttttccattatcaaaccgaacgcggtagcaaaaaacgtcatt
ggtaatatctttgcgcgctttgaagctgcagggttcaaaattgtcggcaccaaaatgctg
cacctgaccgttgaacaggcacgtggcttttatgctgaacacgatggaaaaccgttcttt
gatggtctggttgaattcatgacctctggcccgatcgtggtttccgtgctggaaggtgaa
aacgccgttcagcgtcaccgcgatctgctgggcgcgaccaatccggcaaacgcactggcc
ggtactctgcgcgctgattacgctgacagcctgaccgaaaacggtacccacggttctgat
tccgtcgaatctgccgctcgcgaaatcgcttatttcttcggcgaaggcgaagtgtgcccg
cgcacccgttaa

DBGET integrated database retrieval system