KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4158
Entry
ECH74115_4158     CDS       T00778                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00230  Purine metabolism
ecf01100  Metabolic pathways
ecf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECH74115_4158 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ACI39311
Position
3846217..3846696
AA seq 159 aa
MNHSETITIECTINGMPFQLHAVPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
catgccgtaccaggcacgccgctctcggaattactccgcgaacaagggctgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system