KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4923Help
Entry
ECH74115_4923     CDS       T00778                                 

Definition
(GenBank) inner membrane protein YhjX
  KO
K08177  MFS transporter, OFA family, oxalate/formate antiporter
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecf02000]
    ECH74115_4923
Transporters [BR:ecf02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Oxalate:formate antiporter (OFA) family [TC:2.A.1.11]
    ECH74115_4923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ACI35548
Position
complement(4561484..4562686)
Genome map
AA seq 400 aa AA seqDB search
MTPSNYQRTRWLTLIGTIITQFALGSVYTWSLFNGALSAKLDAPVSQVAFSFGLLSLGLA
ISSSVAGKLQERFGVKRVTIASGILLGLGFFLTAHSDNLMMLWLSAGVLVGLADGAGYLL
TLSNCVKWFPERKGLISAFAIGSYGLGSLGFKFIDTQLLETVGLEKTFVIWGAIALVMIV
FGATLMKDAPKQEVKTSNGVVEKDYTLAESMRKPQYWMLAVMFLTACMSGLYVIGVAKDI
AQSLAHLDVVSAANAVTVISIANLSGRLVLGILSDKIARIRVITIGQVISLVGMAALLFA
PLNAVTFFAAIACVAFNFGGTITVFPSLVSEFFGLNNLAKNYGVIYLGFGIGSICGSIIA
SLFGGFYVKFYVIFALLILSLALSTTIRQPEQKVLREAHI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacaccttcaaattatcagcgtacccgctggttgacactcatcggtactatcattacc
cagtttgcgctggggtcggtttatacctggagcctgtttaacggcgcgctttccgccaag
ctggatgcgccggtaagccaggtcgctttctctttcggcttgttaagtctggggctggca
atatcgtcttctgttgcgggcaaattgcaggaacgttttggtgttaaacgcgtcaccatc
gcttccggcattttgctgggattagggttcttcctgacagcgcattctgacaacctgatg
atgctgtggttaagcgccggtgtgctggtcggtctggcggatggcgcgggttacctgctg
acgctctctaactgcgtgaaatggttcccggagcgtaaaggtctgatctccgcgttcgct
atcggttcttatggtctgggtagcctgggtttcaaatttatcgacacgcagctgctggaa
acggtcggtctggaaaaaacctttgtgatttggggagcgattgcgctggtgatgattgtt
ttcggcgcaacgttaatgaaagacgcaccaaaacaggaagtgaaaaccagcaatggtgtg
gtggagaaagattacacgctggcagagtcgatgcgtaaaccgcagtactggatgttagcg
gtaatgttcctgactgcctgcatgagcggcctgtacgtgattggggtagcgaaagatatc
gcccaaagtctggcacaccttgatgtggtttctgcagccaatgcagtcactgttatttcc
atcgccaacctttcaggtcgtctggtgctgggcattctgtctgacaaaatcgcccgtatc
cgtgttatcaccattggtcaggtaatttcgctggtgggtatggcggccctgctgtttgca
ccattgaatgcagtgacgttctttgcagcgattgcctgcgtggcatttaactttggcggc
actattaccgtctttccgtcactggtcagtgagttcttcggcctcaataacctggcgaaa
aactacggtgtgatttacctcggtttcggtatcggtagcatttgtggttcgattatcgcc
tcactgtttggcggcttctatgtgaagttctacgtcatctttgctctgctgattctgtca
ttggcgctttctacgacgattcgtcagccagagcagaaagtattgcgtgaggcgcatatt
tag

DBGET integrated database retrieval system