KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4929Help
Entry
ECH74115_4929     CDS       T00778                                 

Gene name
tkrA
Definition
(GenBank) 2-ketogluconate reductase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00030  Pentose phosphate pathway
ecf00260  Glycine, serine and threonine metabolism
ecf00620  Pyruvate metabolism
ecf00630  Glyoxylate and dicarboxylate metabolism
ecf01100  Metabolic pathways
ecf01110  Biosynthesis of secondary metabolites
ecf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECH74115_4929 (tkrA)
   00620 Pyruvate metabolism
    ECH74115_4929 (tkrA)
   00630 Glyoxylate and dicarboxylate metabolism
    ECH74115_4929 (tkrA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECH74115_4929 (tkrA)
Enzymes [BR:ecf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     ECH74115_4929 (tkrA)
    1.1.1.81  hydroxypyruvate reductase
     ECH74115_4929 (tkrA)
    1.1.1.215  gluconate 2-dehydrogenase
     ECH74115_4929 (tkrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACI34600
UniProt: B5YVK6
Position
4567989..4568963
Genome map
AA seq 324 aa AA seqDB search
MKPSVILYKALPDDLLQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAAL
LEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVE
VAERVKAGEWTASIGPDWYGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHH
KEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAEQFAKMKSSAIFINAGRGPV
VDENALIAALQKGEIHAAGLDVFEQEPLSVDSPLLSMANVVAVPHIGSATHETRYGMAAC
AVDNLIDALQGKVEKNCVNPHVAD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtccgttatcctctacaaagccttacctgatgatttactgcaacgcctgcaa
gagcatttcaccgttcaccaggtggcaaacctcagcccacaaaccgtcgaacaaaatgca
gcaatttttgccgaagctgaaggtttactgggttcaaacgagaatgttgatgccgcattg
ctggaaaaaatgccgaaactgcgtgccacatcaacgatctccgtcggctatgacaatttt
gatgtcgatgcgcttaccgcccgaaaaattctgctgatgcacacgccaaccgtcttaaca
gaaaccgtcgccgatacgctgatggcgctggtgttgtctaccgctcgtcgggttgtggag
gtagcagaacgggtaaaagcaggcgaatggaccgcgagcataggcccggactggtacggc
actgacgttcaccataaaacactgggcattgtcgggatgggacggatcggtatggcgctg
gcacaacgtgcgcactttggcttcaacatgcccatcctctataacgcgcgccgccaccat
aaagaagcagaagaacgcttcaacgcccgctactgcgatttggatacactgttacaagag
tcagatttcgtttgcctgatcctgccgttaactgatgagacgcatcatctgtttggcgca
gaacaattcgccaaaatgaaatcctccgccattttcattaatgccggacgtggcccggtg
gttgacgaaaatgcactgatcgcagcattgcagaaaggggaaattcacgccgccgggctg
gatgtcttcgaacaagagccactttccgtagattcgccgttgctctcaatggccaacgtc
gtcgcagtaccgcatattggatctgccacccatgagacgcgttatggcatggccgcctgt
gccgtggataatttgattgatgcgttacaaggaaaggttgagaagaactgtgtgaatccg
cacgtcgcggactaa

DBGET integrated database retrieval system