KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4931Help
Entry
ECH74115_4931     CDS       T00778                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07726  putative transcriptional regulator
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecf03000]
    ECH74115_4931
Transcription factors [BR:ecf03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    ECH74115_4931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MqsA_antitoxin HTH_3 HTH_31 VD10_N DUF4248 MerR HTH_17
Motif
Other DBs
NCBI-ProteinID: ACI38927
Position
4570157..4570447
Genome map
AA seq 96 aa AA seqDB search
MEYKDPMHELLSSLEQIVFKDETQKITLTHRTTSCTEIEQLRKGTGLKIDDFARVLGVSV
AMVKEWESRRVKPSSAELKLMRLIQANPALSKQLME
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggaatataaagatccaatgcatgagctgttgagcagcctggaacagattgtttttaaa
gatgaaacgcagaaaattaccctgacgcacagaacaacgtcctgtaccgaaattgagcag
ttacgaaaagggacaggattaaaaatcgatgatttcgcccgggttttgggcgtatcagtc
gccatggtaaaggaatgggaatccagacgcgtgaagccttcaagtgccgaactaaaattg
atgcgtttgattcaagccaacccggcattaagtaagcagttgatggaatag

DBGET integrated database retrieval system