KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4939Help
Entry
ECH74115_4939     CDS       T00778                                 

Definition
(GenBank) putative membrane protein
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YiaAB
Motif
Other DBs
NCBI-ProteinID: ACI38203
Position
complement(4576682..4577023)
Genome map
AA seq 113 aa AA seqDB search
MKTSKTVAKLLFVVGALVYLVGLWISCPLLSGKGYFLGVLMTATFGNYAYLRAEKLGQLD
NFFTHICQLVALITIGLLFIGVLNAPINAYEMVIYPIAFFVCLFGQMRLFRSV
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctcaaaaactgtggcaaaactattatttgttgtcggggcgctggtttatctg
gttgggctatggatctcatgcccattgttgagtggaaaaggctattttcttggcgtgtta
atgacagcaacttttggcaactatgcatatcttcgcgcagaaaaactcgggcaactggat
aatttttttacccatatttgccagttagttgcgttaatcactatcggtctcttgtttatc
ggtgttttaaatgcacctatcaatgcttatgaaatggtgatctaccccatcgcctttttt
gtctgcttgtttggtcaaatgcgtttgtttcgctcggtatga

DBGET integrated database retrieval system