KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4943Help
Entry
ECH74115_4943     CDS       T00778                                 

Gene name
xylG
Definition
(GenBank) D-xylose ABC transporter, ATP-binding protein
  KO
K10545  D-xylose transport system ATP-binding protein [EC:3.6.3.17]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf02010  ABC transporters
Module
ecf_M00215  D-Xylose transport system
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECH74115_4943 (xylG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecf02000]
    ECH74115_4943 (xylG)
Enzymes [BR:ecf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     ECH74115_4943 (xylG)
Transporters [BR:ecf02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Xylose transporter [MD:M00215] [OT]
    ECH74115_4943 (xylG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 AAA_15 RsgA_GTPase AAA_16 MCM AAA_30 AAA_33 AAA_22 AAA_25
Motif
Other DBs
NCBI-ProteinID: ACI38372
Position
4581476..4583017
Genome map
AA seq 513 aa AA seqDB search
MPYLLEMKNITKTFGSVKAIDNVSLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYE
GEIIFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMT
LRCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTASLTEQETSV
LLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSEDDIITMMVG
RELTALYPNEPHTTGDEILRIEHLTAWHPVNRHIKRVNDVSFSLKRGEILGIAGLVGAGR
TETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIAQGIAMVPEDRKRDGIVPVMAVGKN
ITLAALNKFTGGISQLDDAAEQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCL
LLNPRILILDEPTRGIDIGAKYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHE
GKLKANLINHNLTQEQVMEAALRSEHHVEKQSV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgccttatctacttgaaatgaagaacattaccaaaaccttcggcagtgtgaaggcgatt
gataacgtcagcttgcggttgaatgctggcgaaatcgtctcactctgtggggaaaatggg
tctggtaaatcaacgctgatgaaagtgctgtgtggtatttatccccatggctcctacgaa
ggcgaaattatttttgcgggagaagagattcaggcgagtcacatccgcgataccgaacgc
aaaggtatcgccatcattcaccaggaattggccctggtgaaagaattgaccgtgctggaa
aatatcttcctgggtaacgaaataacccacaatggcattatggattatgacctgatgacg
ctacgctgtcagaagctgctcgcacaggtcagtttatccatttcacctgatacccgcgtt
ggcgatttagggcttgggcaacaacaactggttgaaattgccaaggcacttaataaacag
gtgcgcttgttaattctcgatgaaccgacagcctcattaactgagcaggaaacgtcggtt
ttactggatattattcgcgatctacaacagcacggtatcgcctgtatttatatttcgcac
aaactcaacgaagtcaaagcgatttccgatacgatttgcgttattcgcgacggacagcac
attggtacgcgtgatgctgccggaatgagtgaagacgatattatcaccatgatggtcggg
cgagagttaaccgcgctttaccctaatgaaccacataccaccggagatgaaatattacgt
attgaacatctgacggcatggcatccggttaatcgtcatattaaacgagttaatgatgtc
tcgttttccctgaaacgtggcgaaatactgggtattgccggactcgttggtgccggacgt
accgagaccattcagtgcctgtttggtgtgtggcccggacaatgggaaggaaaaatttat
attgatggcaaacaggtagatattcgtaactgtcagcaagccatcgcccaggggattgcg
atggtccccgaagacagaaagcgcgacggcatcgttccggtaatggcggttggtaaaaat
attaccctcgccgcactcaataaatttaccggtggcattagccagcttgatgacgcggca
gagcaaaaatgtattctggaatcaatccagcaactcaaagttaaaacgtcgtcccccgac
cttgctattggacgtttgagcggcggcaatcagcaaaaagcgatcctcgctcgctgtctg
ttacttaacccgcgcattctcattcttgatgaacccaccaggggtatcgatattggcgcg
aaatacgagatctacaaattaattaaccaactcgtccagcagggtattgccgttattgtc
atctcttctgaattacctgaagtgctcggccttagcgatcgtgtactagtaatgcatgaa
gggaaactaaaagccaacctgataaatcataacctgactcaggagcaggtgatggaagcc
gcattgaggagcgaacatcatgtcgaaaagcaatccgtctga

DBGET integrated database retrieval system