KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4944Help
Entry
ECH74115_4944     CDS       T00778                                 

Gene name
xylH
Definition
(GenBank) D-xylose ABC transporter, permease protein
  KO
K10544  D-xylose transport system permease protein
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf02010  ABC transporters
Module
ecf_M00215  D-Xylose transport system
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECH74115_4944 (xylH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecf02000]
    ECH74115_4944 (xylH)
Transporters [BR:ecf02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Xylose transporter [MD:M00215] [OT]
    ECH74115_4944 (xylH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ACI37820
Position
4582995..4584176
Genome map
AA seq 393 aa AA seqDB search
MSKSNPSEVKLAVPTSGGFSGLKSLNLQVFVMIAAIIAIMLFFTWTTDGAYLSARNVSNL
LRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLGGVAAICDVWLGWPLPLTIIVTLVLG
LLLGAWNGWWVAYRKVPSFIVTLAGMLAFRGILIGITNGTTVSPTSAAMSQIGQSYLPAS
TGFIIGALGLMAFVGWQWRGRMRRQALGLQSPASTAVVGRQALTAIIVLGAIWLLNDYRG
VPTPVLLLTLLLLGGMFMATRTAFGRRIYAIGGNLEAARLSGINVERTKLAVFAINGLMV
AIAGLILSSRLGAGSPSAGNIAELDAIAACVIGGTSLAGGVGSVAGAVMGAFIMASLDNG
MSMMDVPTFWQYIVKGAILLLAVWMDSATKRRS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaagcaatccgtctgaagtgaaattggccgtaccgacatccggtggcttctcc
gggctgaaatcactgaatttgcaggtcttcgtgatgattgcagctatcatcgcaatcatg
ctgttctttacctggaccaccgatggtgcctacttaagcgcccgtaacgtctccaacctg
ttacgccagaccgcgattaccggcatcctcgcggtaggaatggtgttcgtcataatttct
gctgaaatcgacctttccgtcggctcaatgatggggctattaggtggcgtcgcggcgatt
tgtgacgtctggctaggctggcctttgccacttaccatcattgtgacgttggttctggga
ctgcttctcggtgcctggaacggatggtgggtcgcgtaccgcaaagtcccttcatttatt
gtcactctcgcgggcatgttggcatttcgcggcatactcattggcatcaccaacggcacg
actgtatcccccaccagcgccgcgatgtcacaaattgggcaaagctatctccccgccagc
accggcttcatcattggcgcgcttggcttaatggcttttgttggctggcaatggcgcgga
agaatgcgccgtcaggctttgggtttgcagtctccagcctctaccgcagtagtcggtcgc
caggctttaaccgctatcatcgtattaggcgcaatctggctgttgaatgattaccgtggc
gttcctactcctgttctgctgctgacgttgctgttactcggcggaatgtttatggcaacg
cggacagcatttggacgacgcatttatgccatcggcggcaatctggaagcagcacgtctc
tccggaattaacgttgaacgcaccaaacttgccgtgttcgctattaacggattaatggta
gccatcgccggattaatcctcagttctcgacttggcgctggttcaccttctgcggggaat
atcgccgagctggacgcaattgcagcatgcgtgattggcggcaccagtctggcaggcggc
gtcgggagcgtggctggagcggtaatgggggcattcatcatggcttcactggataacggt
atgagtatgatggatgtaccgaccttctggcagtatatcgttaaaggtgcgattctgttg
ctggcagtatggatggactccgcaaccaaacgccgttcttga

DBGET integrated database retrieval system